Entry information : WsebGPx01
Entry ID 11197
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: WsebGPx01
Name WsebGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Wallemiomycetes Wallemia
Organism Wallemia sebi    [TaxId: 148960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WsebGPx01
start..stop
S start..stop
RsolGPx01 239 2e-82 4..160 2..159
PcGPx 238 3e-82 4..160 2..159
PbreGPx01 238 2e-81 1..160 65..225
JargGPx01 237 8e-81 3..160 72..230
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93039..93144 106 N° 2 92915..92990 76 N° 3 92667..92864 198 N° 4 92517..92616 100
complement(join(92517..92616,92667..92864,92915..92990,93039..93144))


exon

Literature and cross-references WsebGPx01
DNA ref. JGI genome:   scaffold_23 (93144..92517)
Protein sequence: WsebGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   18024.04  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASEFYNLKAEKPNGQEYSFDTLKDKVVLVVNTASKCGFTPQYTGLEELHQKYKDRGLVVLGFPCNQFGGQEPGTDDDIDNFCKINHGVSFQLFKKSDVNGDKTNEVFKYLKDKKSQLGLTRIKWNFEKFLVDKQGNVVNRYSSMAKPSDIGNDVEKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATCTGAATTCTACAATTTGAAAGCTGAGAAACCAAATGGACAGGAGTACAGCTTTGATACTCTCAAGGACAAAGTCGTATTAGTCGTAAACACTGCTAGTGAGTTCTCTTTT
AACTTTGTAATAATCAACTAATTGTGGATTCTAGGCAAGTGTGGCTTCACACCACAATACACTGGTTTAGAAGAGCTCCACCAGAAGTACAAAGACAGGGGCTTGGTTGTGTAAGTTATA
ACTCTTTCTGATTACGTAATCCCCTTACCGGTTATATTAGCTTGGGATTCCCGTGCAACCAATTTGGTGGCCAGGAGCCTGGTACAGACGATGACATTGACAACTTCTGTAAAATTAACC
ACGGCGTTAGCTTCCAATTATTCAAGAAGTCTGATGTAAACGGTGATAAGACAAATGAAGTTTTCAAGTACCTCAAAGATAAGAAATCTCAATTGGGATTGACCAGGATAAAGTGGAA
GT
GAGTTTCTATTCTTTCTACCTTTTCTTTCCGAACTTACTCGCCACCAGCTTCGAGAAATTTTTGGTTGACAAGCAAGGAAACGTCGTGAACAGATACTCATCAATGGCTAAGCCATCAGA
CATTGGTAACGATGTTGAGAAGCTCCTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCATCTGAATTCTACAATTTGAAAGCTGAGAAACCAAATGGACAGGAGTACAGCTTTGATACTCTCAAGGACAAAGTCGTATTAGTCGTAAACACTGCTAGCAAGTGTGGCTTC
ACACCACAATACACTGGTTTAGAAGAGCTCCACCAGAAGTACAAAGACAGGGGCTTGGTTGT
CTTGGGATTCCCGTGCAACCAATTTGGTGGCCAGGAGCCTGGTACAGACGATGACATT
GACAACTTCTGTAAAATTAACCACGGCGTTAGCTTCCAATTATTCAAGAAGTCTGATGTAAACGGTGATAAGACAAATGAAGTTTTCAAGTACCTCAAAGATAAGAAATCTCAATTGGGA
TTGACCAGGATAAAGTGGAA
CTTCGAGAAATTTTTGGTTGACAAGCAAGGAAACGTCGTGAACAGATACTCATCAATGGCTAAGCCATCAGACATTGGTAACGATGTTGAGAAGCTCCTT

Retrieve as FASTA