Entry information : CgaGPx01
Entry ID 11198
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: CgaGPx01
Name CgaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3005]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Cryptococcus gattii (Filobasidiella gattii)    [TaxId: 292817 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgaGPx01
start..stop
S start..stop
CnGPx01_H99 308 2e-110 1..151 1..151
CnGPx01_JEC21 307 5e-110 1..151 1..151
DcryGPx01 281 2e-99 1..151 1..151
TmesGPx01_Fries 256 1e-89 1..151 1..151
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74290..74313 24 N° 2 74136..74217 82 N° 3 73979..74067 89 N° 4 73822..73908 87
N° 5 73663..73746 84 N° 6 73531..73596 66 N° 7 73436..73459 24  
complement(join(73436..73459,73531..73596,73663..73746,73822..73908,73979..74067 ,74136..74217,74290..74313))


exon

Literature and cross-references CgaGPx01
Protein ref. UniProtKB:   E6RFS6
DNA ref. GenBank:   CP000299.1 (74313..73436)
Protein sequence: CgaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   151
PWM (Da):   %s   16792.52  
PI (pH):   %s   5.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDIYSYSVEFPKSTLPLSELKGKTLLFVNVASKCGLTPQYKDLQALHEKYGDKGLAIIGFPCNFKAQEPGTDDEVLQFCQLNYGVTFPIAKKGDVNGENTQPIWKYLKENAEPPVSEIDWNFSKFLVKDGKITWFPARSTKVSDVEAAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo N, 6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGACATTTACTCTTACTCTGTAAGTTCCGACTTTCCTTCTTACATCTCCTTTATCAAATGCCCGACTGACGACAAGGAATAACACGACTAGGTTGAATTTCCCAAGTCCACCCTT
CCCCTTAGTGAACTGAAGGGCAAGACTCTCTTGTTCGTCAACGTTGCTAGCAAGTGTG
GTAAGTTTTATTCCTTTACTGATAAGTAATTTGGGGTTCACCGTTGACGCATTGTATTTTCT
TCATAGGTTTGACTCCTCAGTACAAGGATCTTCAAGCCTTGCACGAGAAGTATGGGGACAAGGGCTTGGCAATCATTGGTTTCCCTTGCAACCAGGTAAGCACTCATGCGTGATAGTGGA
TTGAGGTGGAAAGGTGGCGTGTGACTGATATGTTTGGCGATGCAGTTTAAGGCTCAGGAGCCTGGGACTGACGATGAGGTTCTTCAATTCTGTCAACTCAACTATGGAGTGACTTTCCCT
ATCGCCAAGAAG
GTATGTGTTTGCCAACTTTAAGGTGACAATGAACCTGATGAAAATTTTGTATCGATTCTCTTTTCTTCTTGATAGGGCGATGTCAATGGTGAAAACACTCAGCCTATC
TGGAAATATCTCAAAGAGAACGCCGAACCTCCTGTCTCTGAAATCGATTGG
GTAAGTCTGTTTCACACCTTCTATACCTCAAAAAAGTGTTAAGGAGCGATACTAACGCCTTTAAAGAAC
TTTTCCAAATTCCTTGTCAAGGATGGAAAGATTACCTGGTTCCCTGCTCGGAGCACTAAGGTT
GTAAGTACCGTCCCTCCCTCCTTACCCTCTCGTGGACTGTCAGAGCTGACTCGACGA
CTTTGTGGGTGTAGAGCGATGTTGAGGCTGCTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGACATTTACTCTTACTCTGTTGAATTTCCCAAGTCCACCCTTCCCCTTAGTGAACTGAAGGGCAAGACTCTCTTGTTCGTCAACGTTGCTAGCAAGTGTGGTTTGACTCCTCAG
TACAAGGATCTTCAAGCCTTGCACGAGAAGTATGGGGACAAGGGCTTGGCAATCATTGGTTTCCCTTGCAACCAG
TTTAAGGCTCAGGAGCCTGGGACTGACGATGAGGTTCTTCAATTC
TGTCAACTCAACTATGGAGTGACTTTCCCTATCGCCAAGAAG
GGCGATGTCAATGGTGAAAACACTCAGCCTATCTGGAAATATCTCAAAGAGAACGCCGAACCTCCTGTCTCTGAAATC
GATTGG
AACTTTTCCAAATTCCTTGTCAAGGATGGAAAGATTACCTGGTTCCCTGCTCGGAGCACTAAGGTTAGCGATGTTGAGGCTGCTCTTTAA

Retrieve as FASTA