Entry information : PterGPx01
Entry ID 11203
Creation 2012-07-18 (Christophe Dunand)
Last sequence changes 2012-07-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PterGPx01
Name PterGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora teres    [TaxId: 53485 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PterGPx01
start..stop
S start..stop
PtritGPx01 515 0 1..268 1..271
AalteGPx01 335 1e-117 13..268 1..239
SturGPx01 330 8e-117 101..268 1..168
ClunGPx01 327 2e-115 101..265 1..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18522..18864 343 N° 2 18942..19207 266 N° 3 19300..19497 198  
join(18522..18864,18942..19207,19300..19497)


exon

Literature and cross-references PterGPx01
DNA ref. JGI genome:   193709 (18522..19497)
Cluster/Prediction ref. JGI gene:   9694
Protein sequence: PterGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269
PWM (Da):   %s   29511.28  
PI (pH):   %s   10.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVLGRNSGVSHVVNGGGARGTAPQRVTRAGASVLKLRDSFTTTIAAASAYHTTGYTASTLRTLHREGLFGRTRIHIQEGFRDQKALSRAFSFTTSKKPAMASATNFYEFKPKDKKGAVYDLSKLNGKVVLVVNTASKCGFTPQFEGLEKLYKEIKAAHPNDFEILGFPCNQFGGQDPGSNEEIQEFCQLNYGVSFPVLGKIVNGATADPAFEWLKNEKPGLMGLKRVKWNFEKFLVGRDGKVKGRWASTKKPEDLKAEIEKELNNK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGTGTTGGGTAGAAACTCCGGTGTATCACATGTTGTGAATGGTGGAGGGGCTAGAGGCACAGCCCCGCAGCGGGTGACGAGGGCGGGAGCTTCGGTCTTAAAGCTTAGGGATTCC
TTTACCACTACTATTGCTGCGGCATCTGCTTATCACACCACTGGATATACTGCTTCGACTCTACGAACTCTACATCGCGAAGGACTTTTTGGAAGGACACGCATACATATACAGGAAGGG
TTTAGAGATCAGAAGGCTTTAAGTAGAGCGTTCAGCTTTACCACATCTAAGAAACCAGCCATGGCATCAGCAACGAACTTTTACGAGTTTAAGCCAAAGGACA
GTACGTCTCGCCTCCCT
CTCCTCCATATCCTCTCTCCCATCCCCTCTAATACACACCCGACTAACACACCACCGCAGAGAAAGGTGCCGTCTACGACCTCTCCAAGCTCAACGGCAAAGTCGTCCTCGTCGTTAACA
CGGCCTCAAAATGCGGTTTCACTCCGCAATTCGAGGGCCTCGAGAAGCTCTACAAGGAAATCAAGGCTGCACACCCAAACGACTTTGAGATTCTAGGTTTCCCTTGCAACCAATTCGGTG
GCCAGGACCCGGGTTCCAACGAGGAAATTCAGGAGTTTTGCCAGTTGAACTACGGTGTTAGCTTCCCCGTGTTGGGCAAGATTGAT
GTATGTTCTCCCTTCCCACCGTCTGTTTCTCCCT
TTGTGGGGCATCGGATACAACGTGTAAGAGAACCATGGCTAACAGAGAATGATAACAGGTCAACGGCGCAACCGCAGACCCCGCTTTCGAATGGCTCAAGAACGAGAAGCCAGGCCTCAT
GGGCTTGAAGCGTGTCAAGTGGAACTTTGAAAAGTTCTTGGTTGGACGGGATGGCAAGGTCAAGGGCAGGTGGGCGAGCACAAAGAAGCCCGAGGATCTCAAGGCGGAGATTGAGAAGGA
GTTGAACAACAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGTGTTGGGTAGAAACTCCGGTGTATCACATGTTGTGAATGGTGGAGGGGCTAGAGGCACAGCCCCGCAGCGGGTGACGAGGGCGGGAGCTTCGGTCTTAAAGCTTAGGGATTCC
TTTACCACTACTATTGCTGCGGCATCTGCTTATCACACCACTGGATATACTGCTTCGACTCTACGAACTCTACATCGCGAAGGACTTTTTGGAAGGACACGCATACATATACAGGAAGGG
TTTAGAGATCAGAAGGCTTTAAGTAGAGCGTTCAGCTTTACCACATCTAAGAAACCAGCCATGGCATCAGCAACGAACTTTTACGAGTTTAAGCCAAAGGACA
AGAAAGGTGCCGTCTAC
GACCTCTCCAAGCTCAACGGCAAAGTCGTCCTCGTCGTTAACACGGCCTCAAAATGCGGTTTCACTCCGCAATTCGAGGGCCTCGAGAAGCTCTACAAGGAAATCAAGGCTGCACACCCA
AACGACTTTGAGATTCTAGGTTTCCCTTGCAACCAATTCGGTGGCCAGGACCCGGGTTCCAACGAGGAAATTCAGGAGTTTTGCCAGTTGAACTACGGTGTTAGCTTCCCCGTGTTGGGC
AAGATTGAT
GTCAACGGCGCAACCGCAGACCCCGCTTTCGAATGGCTCAAGAACGAGAAGCCAGGCCTCATGGGCTTGAAGCGTGTCAAGTGGAACTTTGAAAAGTTCTTGGTTGGACGG
GATGGCAAGGTCAAGGGCAGGTGGGCGAGCACAAAGAAGCCCGAGGATCTCAAGGCGGAGATTGAGAAGGAGTTGAACAACAAGTAA

Retrieve as FASTA