Entry information : COsaCcP
Entry ID 11207
Creation 2012-07-18 (Christophe Dunand)
Last sequence changes 2012-07-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: COsaCcP
Name COsaCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus sativus    [TaxId: 45130 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value COsaCcP
start..stop
S start..stop
CheCcP_C4 755 0 1..373 1..373
AalteCcP01 709 0 1..373 1..374
AbraCcP 701 0 1..373 1..373
PtritCcP 701 0 1..373 1..374
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 480085..480494 410 N° 2 480550..481261 712  
join(480085..480494,480550..481261)


exon

Literature and cross-references COsaCcP
DNA ref. JGI genome:   scaffold_15 (480085..481261)
Cluster/Prediction ref. JGI gene:   193458
Protein sequence: COsaCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   41605.56  
PI (pH):   %s   8.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASRSFSRALRTVAPSFRTTAIRSSARFVAPTQNAFRNQRRGYASQEDGPDKHEGNPTGLAFGAGALLVGAGAYALYTYKPELFGQTSSKVFTPRFEDYQKVYDAIAKRLEENDNYDDGSYGPVLLRLAWHCSGTYDKLTGTGGSNGATMRFAPEADHGANAGLKAARDFLDPVKQAFPWISYSDLWILGGVCAIQEMQGPKIPYRAGRADRDVAFCTPDGRLPDATKDSSHIRAIFGRMGFDDRAMVALSGAHALGRCHTDRSGFDGPWTFSPTTLTNDYFKLLLEEKWAYKKWNGPKQFEDVKTKSLMMLPTDMELVKDKSFKQYTQLYAKDNDVFFKDFAEAVTTLFELGVPFQQPEDQRWVFKSSFD

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCCTCTCGAAGCTTCTCCCGCGCTCTGCGCACTGTTGCTCCCTCATTCCGCACCACCGCCATCCGCTCATCTGCCCGCTTCGTTGCACCTACACAAAACGCCTTCCGCAAC
CAACGACGCGGATACGCCTCCCAGGAAGATGGCCCTGATAAGCATGAGGGCAACCCAACCGGTCTAGCTTTCGGTGCTGGTGCTCTGCTTGTCGGTGCTGGTGCCTACGCCCTATACACA
TACAAGCCAGAGCTCTTTGGCCAGACTAGCTCCAAGGTCTTCACTCCCAGGTTCGAGGATTACCAGAAGGTCTACGACGCAATTGCCAAGAGATTGGAGGAGAACGACAACTACGATGAT
GGCAGCTACGGTCCTGTGCTGCTGCGTTTGGCATGGCACTGCTCGGGAAC
GTAAGTATACTCAATTGTACTTGATACCACTGAACCAACAACTGACATGCTACAGCTATGACAAGTTGAC
GGGAACTGGTGGCTCCAACGGCGCAACCATGCGCTTTGCCCCCGAAGCTGACCACGGTGCCAATGCTGGTCTCAAGGCTGCTCGCGACTTCCTCGACCCTGTCAAGCAGGCTTTCCCTTG
GATTAGCTACTCGGACTTGTGGATTCTCGGTGGTGTTTGTGCCATCCAGGAGATGCAGGGCCCCAAGATCCCTTATCGTGCTGGCCGTGCCGACCGTGATGTTGCCTTCTGCACTCCTGA
TGGCCGTCTGCCGGATGCCACCAAGGATAGCAGCCACATTCGCGCCATCTTTGGCCGCATGGGATTCGATGACCGTGCTATGGTCGCCCTCTCTGGCGCCCACGCCCTCGGCCGCTGCCA
TACTGACCGCTCCGGCTTCGACGGCCCCTGGACCTTCTCTCCCACCACCTTGACCAACGATTACTTCAAGCTGCTTCTCGAGGAGAAGTGGGCGTACAAGAAGTGGAATGGTCCCAAGCA
GTTTGAGGATGTCAAGACCAAGAGTCTTATGATGCTTCCCACTGACATGGAGCTTGTCAAGGACAAGAGCTTCAAGCAGTACACCCAACTGTATGCCAAGGACAATGATGTTTTCTTCAA
GGACTTTGCCGAGGCAGTCACGACCCTGTTTGAGCTTGGCGTGCCCTTCCAGCAGCCCGAAGACCAGCGATGGGTCTTCAAGAGCTCTTTTGATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCCTCTCGAAGCTTCTCCCGCGCTCTGCGCACTGTTGCTCCCTCATTCCGCACCACCGCCATCCGCTCATCTGCCCGCTTCGTTGCACCTACACAAAACGCCTTCCGCAAC
CAACGACGCGGATACGCCTCCCAGGAAGATGGCCCTGATAAGCATGAGGGCAACCCAACCGGTCTAGCTTTCGGTGCTGGTGCTCTGCTTGTCGGTGCTGGTGCCTACGCCCTATACACA
TACAAGCCAGAGCTCTTTGGCCAGACTAGCTCCAAGGTCTTCACTCCCAGGTTCGAGGATTACCAGAAGGTCTACGACGCAATTGCCAAGAGATTGGAGGAGAACGACAACTACGATGAT
GGCAGCTACGGTCCTGTGCTGCTGCGTTTGGCATGGCACTGCTCGGGAAC
CTATGACAAGTTGACGGGAACTGGTGGCTCCAACGGCGCAACCATGCGCTTTGCCCCCGAAGCTGACCAC
GGTGCCAATGCTGGTCTCAAGGCTGCTCGCGACTTCCTCGACCCTGTCAAGCAGGCTTTCCCTTGGATTAGCTACTCGGACTTGTGGATTCTCGGTGGTGTTTGTGCCATCCAGGAGATG
CAGGGCCCCAAGATCCCTTATCGTGCTGGCCGTGCCGACCGTGATGTTGCCTTCTGCACTCCTGATGGCCGTCTGCCGGATGCCACCAAGGATAGCAGCCACATTCGCGCCATCTTTGGC
CGCATGGGATTCGATGACCGTGCTATGGTCGCCCTCTCTGGCGCCCACGCCCTCGGCCGCTGCCATACTGACCGCTCCGGCTTCGACGGCCCCTGGACCTTCTCTCCCACCACCTTGACC
AACGATTACTTCAAGCTGCTTCTCGAGGAGAAGTGGGCGTACAAGAAGTGGAATGGTCCCAAGCAGTTTGAGGATGTCAAGACCAAGAGTCTTATGATGCTTCCCACTGACATGGAGCTT
GTCAAGGACAAGAGCTTCAAGCAGTACACCCAACTGTATGCCAAGGACAATGATGTTTTCTTCAAGGACTTTGCCGAGGCAGTCACGACCCTGTTTGAGCTTGGCGTGCCCTTCCAGCAG
CCCGAAGACCAGCGATGGGTCTTCAAGAGCTCTTTTGATTAG

Retrieve as FASTA