Entry information : OsPrx112
Entry ID 1122
Creation 2005-07-19 (Filippo Passardi)
Last sequence changes 2005-07-19 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx112
Name OsPrx112
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Endosperm
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx112
start..stop
S start..stop
OsPrx111 538 0 1..314 1..316
OruPrx111 538 0 1..314 1..316
OsPrx114 484 1e-174 1..314 1..310
TaPrx113-1A 480 5e-173 2..314 3..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28624899..28625108 210 N° 2 28625224..28625400 177 N° 3 28625508..28625673 166 N° 4 28625761..28626152 392
join(28624899..28625108,28625224..28625400,28625508..28625673,28625761..28626152 )


exon

Literature and cross-references OsPrx112
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q0D3N0
DNA ref. GenBank:   NC_008400.1 (28624899..28626149)
Cluster/Prediction ref. UniGene:   Os.11556
Protein sequence: OsPrx112
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (291)
PWM (Da):   %s   32471.89 (30379.9)  
PI (pH):   %s   5.63 (5.63) Peptide Signal:   %s   cut: 24 range:24-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASSVSLMLLVAAAMASAASAQLSATFYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQEQNAGPNAGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTANESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQCQNFRDRLYNETNIDSSFATALKANCPRPTGSGDSNLAPLDTTTPNAFDSAYYTNLLSNKGLLHSDQVLFNGGSTDNTVRNFSSNTAAFNSAFTAAMVKMGNISPLTGTQGQIRLNCSKVN

Retrieve as FASTA  
Remarks chromosome 7. 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGGCTTCTTCTGTCAGCTTAATGCTGCTCGTGGCTGCAGCTATGGCCTCAGCCGCCTCGGCGCAGCTGTCGGCGACGTTCTACGACACGTCGTGCCCAAACGCATTGTCCACC
ATCAAGAGCGCAGTGACGGCCGCCGTGAACAGCGAGCCCCGAATGGGAGCCTCGCTGGTCAGGCTGCACTTCCACGACTGCTTCGTCCAA
GCAAGTTTTGATCACCTAATCTAATCAGCT
GTACAAGTAGTTCTCCTTAGACTGTACTTTGAGACAAGGAAATTAATAACAGAGGATGTATCTATGGACTTCACTGATGATGCAGGGCTGTGACGCGTCTGTTCTGCTGTCCGGCCAGGA
GCAGAATGCAGGCCCGAACGCTGGGTCACTTCGGGGATTCAACGTCGTCGACAACATCAAGACGCAGGTCGAGGCCATCTGCAGCCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGC
CGCCCGTGACTCCGTCGTCGCG
GTAAGATCACGGATGAGATTACTACATGATGCATATATTTCTTGTAGACTGTAGTAGTACGTACTCCTAATCGCTCTTGGTTTGGTTTGGAATCCTTA
TATTTGCAGCTCGGAGGGCCGTCGTGGACGGTTCTATTGGGAAGAAGGGACTCCACCACTGCGAACGAAAGCCAAGCAAATACCGACCTCCCTGCCCCTTCCTCTAGCCTCGCTGAACTT
ATCGGCAATTTCTCCAGAAAGGGACTCGACGTAACCGACATGGTTGCTCTCTCAG
GTACATATATATGTACACAGATTATATCAGTGATTGATTCTCTTACAAATTTTCTGATAAGAATC
ATAATACGATGAGAACTTGCAGGCGCACACACGATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGGCTCTACAACGAGACAAACATCGACTCCAGCTTCGCGACGGCGCTCAAGGCC
AACTGCCCACGGCCGACGGGCAGCGGCGACAGCAACCTGGCGCCGCTGGACACGACGACGCCCAACGCCTTCGACAGCGCCTACTACACCAACCTGCTGTCCAACAAGGGCCTCCTGCAC
TCCGACCAGGTGCTCTTCAACGGCGGCAGCACGGACAACACGGTCAGGAACTTCTCCTCCAACACGGCGGCGTTCAACAGCGCCTTCACGGCGGCCATGGTGAAGATGGGGAACATCTCG
CCCTTGACTGGAACCCAGGGGCAGATCAGGCTCAACTGCTCCAAGGTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGGCTTCTTCTGTCAGCTTAATGCTGCTCGTGGCTGCAGCTATGGCCTCAGCCGCCTCGGCGCAGCTGTCGGCGACGTTCTACGACACGTCGTGCCCAAACGCATTGTCCACC
ATCAAGAGCGCAGTGACGGCCGCCGTGAACAGCGAGCCCCGAATGGGAGCCTCGCTGGTCAGGCTGCACTTCCACGACTGCTTCGTCCAA
GGCTGTGACGCGTCTGTTCTGCTGTCCGGC
CAGGAGCAGAATGCAGGCCCGAACGCTGGGTCACTTCGGGGATTCAACGTCGTCGACAACATCAAGACGCAGGTCGAGGCCATCTGCAGCCAGACCGTCTCCTGCGCCGACATCCTCGCC
GTCGCCGCCCGTGACTCCGTCGTCGCG
CTCGGAGGGCCGTCGTGGACGGTTCTATTGGGAAGAAGGGACTCCACCACTGCGAACGAAAGCCAAGCAAATACCGACCTCCCTGCCCCTTCC
TCTAGCCTCGCTGAACTTATCGGCAATTTCTCCAGAAAGGGACTCGACGTAACCGACATGGTTGCTCTCTCAG
GCGCACACACGATCGGGCAGGCGCAGTGCCAGAACTTCAGGGACAGG
CTCTACAACGAGACAAACATCGACTCCAGCTTCGCGACGGCGCTCAAGGCCAACTGCCCACGGCCGACGGGCAGCGGCGACAGCAACCTGGCGCCGCTGGACACGACGACGCCCAACGCC
TTCGACAGCGCCTACTACACCAACCTGCTGTCCAACAAGGGCCTCCTGCACTCCGACCAGGTGCTCTTCAACGGCGGCAGCACGGACAACACGGTCAGGAACTTCTCCTCCAACACGGCG
GCGTTCAACAGCGCCTTCACGGCGGCCATGGTGAAGATGGGGAACATCTCGCCCTTGACTGGAACCCAGGGGCAGATCAGGCTCAACTGCTCCAAGGTTAACTAG

Retrieve as FASTA