Entry information : BrPrx12-1Aa_other (Bra003918)
Entry ID 11226
Creation 2012-07-23 (Christophe Dunand)
Last sequence changes 2014-04-07 (Maxime Neel)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-08 (Christophe Dunand)
Peroxidase information: BrPrx12-1Aa_other (Bra003918)
Name (synonym) BrPrx12-1Aa_other (Bra003918)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Brassica
Organism Brassica rapa    [TaxId: 3711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BrPrx12-1Aa_other
start..stop
S start..stop
BrPrx12-1Ab_other 696 0 1..362 1..362
TsPrx12 683 0 1..362 1..363
ThPrx12 684 0 1..362 23..385
AhalPrx49 669 0 1..362 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15747670..15747945 276 N° 2 15748650..15748844 195 N° 3 15748944..15749561 618  
join(15747670..15747945,15748650..15748844,15748944..15749561)


exon

Literature and cross-references BrPrx12-1Aa_other (Bra003918)
DNA ref. Phytozome 12:   A07 (20249506..20247616)
EST ref. GenBank:   GR718347.1 [5' end]   GR721804.1 [3' end]   EX140366.1 [Fragment]
Protein sequence: BrPrx12-1Aa_other (Bra003918)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (331)
PWM (Da):   %s   39754.57 (36299.6) Transmb domain:   %s   o10-29i
PI (pH):   %s   9.29 (8.92) Peptide Signal:   %s   cut: 32 range:32-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGLSKRIFTFLMLISLVALALNLLANVEAQNKKKPRRDVPIVKGLSWSFYQKACPKVEKIIRKELKKVFKRDIGLAAAILRIHFHDCFVQGCEGSVLLDGSASGPGEQSSIPNLTLRQAAFVVINNLRALVHKQCGQVVSCSDILALAARDSVVLSGGPDYDVPLGRRDSLAFASQNTTLNNLPPPFAKASQLITDFANRNLNITDLVALSGGHTIGIAHCPSFTGRLYPNQDPTMNKFFANSLKRTCPTANSSNTQVNDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFVDKRTRGIVESFAIDQRLFFDHFAVAMIKMGQMSVLTGSQGEIRSNCSARNTGSFMSVLEEGILEEALSMI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 5 ESTs (EX062260.1, EX046112.1).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTTTTTGA ACACAATCAT AATATGAATT TAAGAGCGAG AAACATTAAT GTTTTCAATA TTTGTCTGTC TTATAGCATT TTTTAATGTC ATTTTTTTCT CAATTACTAA GCAACATTTC  ATATTATTAG TTATTAGTAA TTTTTATTGT TTATTCACCT GCATGTGGGC TGAAAGTATG AATTTTAGAG TCAAAACATA TGATGATTTT GTTCGTCATA TTATCAATCA GAGAGACCCT  TTTTGACACA GCTCACAATT CAAAAACTGA TTATGTGTAC TGGAGTTTTT TCGAGGAAAT TTTCAAGAGG CAAACACATA AAAGAAGAAA AATGATTTAT TTTTAGATAA AAAACTGTTT  TTTTAGTCGA AAGATGATGA GTTTCCACGA TAAAAGCAGA TGATGATAAA CTTAATTGCG ATAATATCCT TTTATTTTTT GTGTGTGACT GTGTATAAAA AAGAAGGACA GTTTTAAAAA  TTTAACATAA GATTTAGATT AAAGCTACAA CTATTAGTTA AATGTTTCTT TGCTAAAAAT AATCGAGATG ACATCGTTAG AAGCTAAATT AGACCAAACT TGAAAGAATA ATTATATTTT  ATGGTTTGTG ATTTGATTTT TAAAATAATT AGATTCTGTT TAGCTAACTA AGTTTATGAT TTATAAAATA AATAGATAAA TTTGACGTGT AATTTTTAGC TAAAATAATA AAATCACACT  AATAAAGAAA CATACAGAAA TAGAAGAAGA TATGAAAAAG ATGAAAAAAA GAGAGAATGC AAAGATGAGA AGAGATGAAA TCACAACAAG AAACGGCCAC AATGGTGTAA ATATAAATCT  GCAAAAGACA AAGTCAAATG ATGATAAAGG CTTCTACTTT AGAAATCGCT AAACACGCAT GGATCCAATT TTTATAGTTT GTATCCAAAC TAGATTTAGT CAAAACTCAA TATCAGAAAA  ACACATTAAC TGATTCAAAC AATTATCCCA ATTTTGGCTA TACAAAAGAG AAGTCAAGGC AGCAAATACG AAAAAAGAAA TAAAGAAATT CACTACCCTG ATTGAAAAAG AACATGATCA  AGCTTGAGAG TAAGAAGAAA GGTTAAGGAG AAGAGAAAAC ATGCGCTGAA ACTGCTTGAA ACGACTCACT ACTCTTCTCC AACTCACTAC TCTTCTGTGA ACCAATATTT TTTTATCCTG  AAGTCTCTAA ATCACTCAGA GAGATCTTTT TTTTTTGACA CAACTCACAA TTCAAAATCT GATTGTGTGA AAGTGGAGTT TTTTCGCAAA AAAATTCAAG AGGCAACGCA CATAAAAGAA  GAGAAAATGA TTTGTTCTTA GAAAAAAGAA ACGATTTTTT CGAGTCGACA GATGACAAGT TTTCATTACA AAGCAAATGT ATGACAAACT TAGTTTATGA TAATAAATTT TAATTTTTTG  TGTGTGACTG TGTATAAAAG TGAATGAGAA TTTAGAAAAT TTAACATTGT ATTTAACTAT TAGTTATATG TTTCATTTTT AAAAATAGTC AATGTGACAT ATCGATATAA GCTAAACTAA  AACAAACTTT TTTAAAAAAA TTATATTTTT ATGATTTTAA CAGTTAATTA AGTTTATGAT TTGTAAAATA AAAAGATAAA TTTGACGTGA TAAATTATAC GTTTTAATAT ATTTAAATTA  ATTATTCACC CGCCCGTAGG GCGGGTTTAA TCCTAGTTGA ACTAGTAATA TAGTTTTAAG CAAAACGAAA GAAAACTAGT AATATCGTTG CTTTAAGATT TCTCTTCTAA ATAAAAAAAA  ATCATTCTTT AAAAAGAAAT TCCATTAAAC AAACAAAATA AGTAAAATTC TTTAGTATTT TATTTTCCTT ATTAAAATAT CTACTTAAAA CAACACAAGG ACCACATTTG GCTATAAAAT 
GAATTCCTCC TCCAAAGAAC AACAAGAAGA GATAGAGAAG AAAAAAAGCT TCGGTCAAGA AAAAAAAAGA GAGAGAAAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGTTTATCTAAACGTATCTTCACGTTTCTGATGTTGATCTCGTTAGTAGCGCTGGCACTGAACCTTCTAGCCAACGTAGAGGCTCAGAATAAGAAGAAGCCAAGGAGAGAT
GTTCCTATAGTGAAAGGTCTCTCATGGAGCTTTTACCAGAAAGCATGTCCGAAAGTGGAAAAAATCATCAGGAAAGAGCTCAAGAAAGTATTCAAGAGAGACATTGGTTTAGCCGCAGCC
ATCCTTCGTATACATTTCCATGACTGCTTCGTTCAG
GTCTATCTTTATTCATCTTTTCTCATTTTTTTGTTGGTTTTAAGCAACATAGATATGTTAGATAGCTAAGGAACCATATGAATC
AATACCCACGCACAAAAATAGGAATATCGTTGTGTTTTCTAAATATATGAAAATGAAAATTTTAAGAAATAAACAGGTTTGAGTATTCTTAAAAAAATGCTGTCACGTGTTAAAGTAAAT
CAGACCAAAATAACCTTAAGAAAGACATTAAACCGTCTCGAAATTCTCATGAATAAGAACAAATTTTCTTCGTGTAAAGTGTTAACACTGATTTGTTTTTAAATTGAAAGTAACACTAAT
TAAATGTCGAAGATATTATCGAGTTGTGTTGTCGCATTAATACTTTCACCCGCTTTTCTAGGGTTAGTTGAGTCTCTTTTAATGAACGTCAATAATATCTTAATTAAGAAATAAATATTG
AACCAATGGCACAGCTACAAATAGGGAGATGCTACAAGAATCAATAATTTATATATATATACTGATGTATTTAACTGATTTATAAAATATATTAATTCATCTAGACAATCCGGATATTTG
TGGTGTTACTTGCAACACACATATATTGAAGTGTGGAGTACTTTGATCAGACAAATAATTTCATAAGAAAATCTTGAATGTAATTTGTCATTTATGGCTTTCCTTACGAGAATTAATATT
TAAAAAAAAAACGAAAACAGGGATGTGAAGGTTCAGTGCTGCTAGATGGATCAGCGAGTGGACCAGGAGAACAATCATCGATCCCTAATCTGACACTGCGTCAAGCCGCCTTTGTAGTCA
TCAATAACCTTCGTGCCCTCGTACACAAGCAGTGCGGCCAAGTCGTCTCTTGCTCTGACATCCTCGCTCTAGCCGCACGTGACTCTGTCGTCCTA
GTAACCAACTCTCTCTTCAATCAGA
ACTCTCAAACTACATATTGGTGTAGTTACTAACTACTTAACTGATAATTACATTTTTTGTATAAATTAATGTAGTCAGGAGGACCAGACTATGATGTGCCACTTGGCCGACGCGACTCAC
TAGCGTTCGCGAGCCAGAACACGACGTTAAATAACCTGCCGCCACCATTCGCCAAAGCGAGCCAGCTCATAACCGACTTCGCCAATAGAAACCTCAACATCACCGACTTAGTTGCACTTT
CAGGTGGCCACACCATCGGAATTGCGCATTGTCCCTCGTTCACAGGCCGGCTCTACCCGAACCAAGACCCAACCATGAACAAGTTCTTCGCCAACAGCCTCAAACGAACGTGTCCCACCG
CTAACTCGAGCAACACACAAGTGAATGACATAAGAAGTCCCGATGTTTTCGACAACAAGTACTACGTTGATCTCATGAACCGACAAGGGTTGTTCACTTCTGACCAGGATCTGTTCGTGG
ACAAGAGGACACGTGGTATTGTGGAGAGCTTTGCGATTGATCAAAGGCTGTTTTTTGATCATTTCGCAGTGGCTATGATCAAGATGGGTCAGATGAGTGTCTTGACGGGGTCACAAGGAG
AGATTCGTTCAAACTGTTCCGCGAGAAACACGGGAAGTTTCATGTCTGTTTTGGAAGAAGGCATACTCGAGGAAGCTCTTTCCATGATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGTTTATCTAAACGTATCTTCACGTTTCTGATGTTGATCTCGTTAGTAGCGCTGGCACTGAACCTTCTAGCCAACGTAGAGGCTCAGAATAAGAAGAAGCCAAGGAGAGAT
GTTCCTATAGTGAAAGGTCTCTCATGGAGCTTTTACCAGAAAGCATGTCCGAAAGTGGAAAAAATCATCAGGAAAGAGCTCAAGAAAGTATTCAAGAGAGACATTGGTTTAGCCGCAGCC
ATCCTTCGTATACATTTCCATGACTGCTTCGTTCAG
GGATGTGAAGGTTCAGTGCTGCTAGATGGATCAGCGAGTGGACCAGGAGAACAATCATCGATCCCTAATCTGACACTGCGTCAA
GCCGCCTTTGTAGTCATCAATAACCTTCGTGCCCTCGTACACAAGCAGTGCGGCCAAGTCGTCTCTTGCTCTGACATCCTCGCTCTAGCCGCACGTGACTCTGTCGTCCTA
TCAGGAGGA
CCAGACTATGATGTGCCACTTGGCCGACGCGACTCACTAGCGTTCGCGAGCCAGAACACGACGTTAAATAACCTGCCGCCACCATTCGCCAAAGCGAGCCAGCTCATAACCGACTTCGCC
AATAGAAACCTCAACATCACCGACTTAGTTGCACTTTCAGGTGGCCACACCATCGGAATTGCGCATTGTCCCTCGTTCACAGGCCGGCTCTACCCGAACCAAGACCCAACCATGAACAAG
TTCTTCGCCAACAGCCTCAAACGAACGTGTCCCACCGCTAACTCGAGCAACACACAAGTGAATGACATAAGAAGTCCCGATGTTTTCGACAACAAGTACTACGTTGATCTCATGAACCGA
CAAGGGTTGTTCACTTCTGACCAGGATCTGTTCGTGGACAAGAGGACACGTGGTATTGTGGAGAGCTTTGCGATTGATCAAAGGCTGTTTTTTGATCATTTCGCAGTGGCTATGATCAAG
ATGGGTCAGATGAGTGTCTTGACGGGGTCACAAGGAGAGATTCGTTCAAACTGTTCCGCGAGAAACACGGGAAGTTTCATGTCTGTTTTGGAAGAAGGCATACTCGAGGAAGCTCTTTCC
ATGATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGG GTTTATCTAA ACGTATCTTC ACGTTTCTGA TGTTGATCTC GTTAGTAGCG CTGGCACTGA ACCTTCTAGC CAACGTAGAG GCTCAGAATA AGAAGAAGCC AAGGAGAGAT  GTTCCTATAG TGAAAGGTCT CTCATGGAGC TTTTACCAGA AAGCATGTCC GAAAGTGGAA AAAATCATCA GGAAAGAGCT CAAGAAAGTA TTCAAGAGAG ACATTGGTTT AGCCGCAGCC  ATCCTTCGTA TACATTTCCA TGACTGCTTC GTTCAGGGAT GTGAAGGTTC AGTGCTGCTA GATGGATCAG CGAGTGGACC AGGAGAACAA TCATCGATCC CTAATCTGAC ACTGCGTCAA  GCCGCCTTTG TAGTCATCAA TAACCTTCGT GCCCTCGTAC ACAAGCAGTG CGGCCAAGTC GTCTCTTGCT CTGACATCCT CGCTCTAGCC GCACGTGACT CTGTCGTCCT ATCAGGAGGA  CCAGACTATG ATGTGCCACT TGGCCGACGC GACTCACTAG CGTTCGCGAG CCAGAACACG ACGTTAAATA ACCTGCCGCC ACCATTCGCC AAAGCGAGCC AGCTCATAAC CGACTTCGCC  AATAGAAACC TCAACATCAC CGACTTAGTT GCACTTTCAG GTGGCCACAC CATCGGAATT GCGCATTGTC CCTCGTTCAC AGGCCGGCTC TACCCGAACC AAGACCCAAC CATGAACAAG  TTCTTCGCCA ACAGCCTCAA ACGAACGTGT CCCACCGCTA ACTCGAGCAA CACACAAGTG AATGACATAA GAAGTCCCGA TGTTTTCGAC AACAAGTACT ACGTTGATCT CATGAACCGA  CAAGGGTTGT TCACTTCTGA CCAGGATCTG TTCGTGGACA AGAGGACACG TGGTATTGTG GAGAGCTTTG CGATTGATCA AAGGCTGTTT TTTGATCATT TCGCAGTGGC TATGATCAAG  ATGGGTCAGA TGAGTGTCTT GACGGGGTCA CAAGGAGAGA TTCGTTCAAA CTGTTCCGCG AGAAACACGG GAAGTTTCAT GTCTGTTTTG GAAGAAGGCA TACTCGAGGA AGCTCTTTCC 
ATGATCTAA 

Retrieve as FASTA