Entry information : OsPrx113
Entry ID 1123
Creation 2006-08-25 (Filippo Passardi)
Last sequence changes 2006-08-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx113
Name OsPrx113
Class Class III peroxidase    [Orthogroup: Prx203]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx113
start..stop
S start..stop
OsPrx114 469 1e-168 1..314 1..311
OsPrx112 442 4e-158 1..313 1..314
TaPrx113-1D 429 6e-153 1..314 1..312
SiPrx132 429 9e-153 27..313 26..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28630622..28630828 207 N° 2 28630983..28631156 174 N° 3 28631258..28631426 169 N° 4 28631541..28631935 395
join(28630622..28630828,28630983..28631156,28631258..28631426,28631541..28631935 )


exon

Literature and cross-references OsPrx113
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XIX1
DNA ref. GenBank:   NC_008400.1 (28630622..28631932)
Cluster/Prediction ref. UniGene:   Os.11770
Protein sequence: OsPrx113
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (292)
PWM (Da):   %s   32330.21 (30257.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.72 (7.72) Peptide Signal:   %s   cut: 23 range:23-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASSLGLLLMLAALVSTATAHLSPTFYDTSCPRAMSIIKSTVTAAVNNEPRMGASLLRLHFHDCFVQGCDASILLAGNERNAAPNFSVRGYDVIDSIKTQIEAVCKQTVSCADILTVAARDSVVALGGPSWSVPLGRRDSTGAATAAQVISSLAPSTDSLAQLISAYASKGLSATDLVALSGAHTIGMARCRGFRTRLYNETNIDAAFAAALKANCPATPGSGDGNLAPLDTTTPTAFDNAYYRNLLSNKGLLHSDQELFSNGSTDNTVRSFASSAAAFGAAFATAMVKMGNISPLTGTQGQIRLICSAVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns) and 3 cDNA and 13 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCCTCTTCTCTTGGCCTATTACTGATGCTCGCGGCGCTGGTCTCCACGGCCACCGCGCATTTGTCGCCGACGTTCTACGACACGTCGTGCCCCCGAGCCATGTCCATCATC
AAGAGCACCGTGACGGCCGCCGTGAACAACGAGCCACGCATGGGCGCGTCTCTGCTCAGGCTGCACTTCCACGACTGCTTCGTCCAA
GCACGTTTCCATCTCACAAACCACCCTGTTTTT
TTTTTTTACTTTGATTTAAGGCCGAAAAGTAGCTAACAGGTTTGCCTGTCTGTCAGACTACGTGAGTTAGCAGCGTTGCAAGAAAATAATCGTGGCTTAATTTTTGTCTGAATCAACACA
GGGCTGTGACGCCTCAATTTTGCTGGCCGGAAACGAGAGGAATGCAGCCCCAAACTTTTCTGTCAGAGGCTACGACGTCATCGACAGCATCAAGACGCAGATCGAGGCCGTGTGCAAGCA
GACCGTCTCCTGCGCCGACATCCTCACCGTCGCCGCCCGCGACTCTGTCGTCGCG
GTAACCATGCATGCATATATCAACGACACAAGATATCGAGCTCGCGATTACGAATTCTGTGATGC
TGAATTGCTTTATTTGGTTTTTAATTTGGCATGCAGCTTGGAGGTCCGTCATGGAGTGTTCCGCTAGGGAGAAGGGACTCCACCGGAGCCGCTACCGCGGCCCAGGTGATTAGCAGCCTT
GCTCCTTCTACAGATAGCCTCGCACAGCTCATCAGCGCGTACGCGAGCAAGGGACTTAGCGCCACTGACTTGGTTGCTCTCTCAG
GTGCACACAATATATATAACTCCTCGATCGATCTC
CTAATCAACCATGGAAGTGTAGTAAACAACAGCTTGTGTTGAAATTTGAAAACGATATGTTTTTGTTTCAATTATGCAGGTGCGCACACGATTGGTATGGCACGGTGCAGGGGCTTCAGG
ACGAGGCTATACAACGAGACCAACATCGACGCCGCCTTTGCGGCGGCGCTCAAGGCCAACTGCCCGGCGACGCCGGGCAGCGGCGACGGCAACCTGGCGCCGCTGGACACGACGACGCCC
ACCGCGTTCGACAACGCCTACTACCGCAACCTGCTGTCGAACAAGGGGCTCCTGCACTCCGACCAGGAGCTGTTCAGCAACGGCAGCACGGACAACACGGTCAGGAGCTTCGCGTCCAGC
GCGGCGGCGTTCGGCGCCGCCTTCGCGACGGCCATGGTGAAGATGGGGAACATCTCGCCGCTGACCGGGACACAGGGACAGATCAGGCTCATCTGCTCCGCCGTCAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCCTCTTCTCTTGGCCTATTACTGATGCTCGCGGCGCTGGTCTCCACGGCCACCGCGCATTTGTCGCCGACGTTCTACGACACGTCGTGCCCCCGAGCCATGTCCATCATC
AAGAGCACCGTGACGGCCGCCGTGAACAACGAGCCACGCATGGGCGCGTCTCTGCTCAGGCTGCACTTCCACGACTGCTTCGTCCAA
GGCTGTGACGCCTCAATTTTGCTGGCCGGAAAC
GAGAGGAATGCAGCCCCAAACTTTTCTGTCAGAGGCTACGACGTCATCGACAGCATCAAGACGCAGATCGAGGCCGTGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCGTCGCC
GCCCGCGACTCTGTCGTCGCG
CTTGGAGGTCCGTCATGGAGTGTTCCGCTAGGGAGAAGGGACTCCACCGGAGCCGCTACCGCGGCCCAGGTGATTAGCAGCCTTGCTCCTTCTACAGAT
AGCCTCGCACAGCTCATCAGCGCGTACGCGAGCAAGGGACTTAGCGCCACTGACTTGGTTGCTCTCTCAG
GTGCGCACACGATTGGTATGGCACGGTGCAGGGGCTTCAGGACGAGGCTA
TACAACGAGACCAACATCGACGCCGCCTTTGCGGCGGCGCTCAAGGCCAACTGCCCGGCGACGCCGGGCAGCGGCGACGGCAACCTGGCGCCGCTGGACACGACGACGCCCACCGCGTTC
GACAACGCCTACTACCGCAACCTGCTGTCGAACAAGGGGCTCCTGCACTCCGACCAGGAGCTGTTCAGCAACGGCAGCACGGACAACACGGTCAGGAGCTTCGCGTCCAGCGCGGCGGCG
TTCGGCGCCGCCTTCGCGACGGCCATGGTGAAGATGGGGAACATCTCGCCGCTGACCGGGACACAGGGACAGATCAGGCTCATCTGCTCCGCCGTCAACTCGTGA

Retrieve as FASTA