Entry information : OsPrx114
Entry ID 1124
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx114
Name OsPrx114
Class Class III peroxidase    [Orthogroup: Prx083]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx114
start..stop
S start..stop
TaPrx113-1D 504 0 2..311 3..312
TmPrx01 492 9e-178 2..311 3..312
TaPrx113-1A 492 9e-178 2..311 3..312
AvePrx113-1A 492 9e-178 2..311 3..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28634935..28635138 204 N° 2 28635393..28635569 177 N° 3 28635856..28636021 166 N° 4 28636093..28636481 389
join(28634935..28635138,28635393..28635569,28635856..28636021,28636093..28636481 )


exon

Literature and cross-references OsPrx114
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XIX0
DNA ref. GenBank:   NC_008400.1 (28634935..28636478)
Protein sequence: OsPrx114
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (290)
PWM (Da):   %s   32412.04 (30426.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.49 (6.10) Peptide Signal:   %s   cut: 22 range:22-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKATCISLLVVVALATAASAQLSATFYDTSCPRAMSIIKSAVTAAVNSEPRMGASLLRLHFHDCFVQGCDASVLLSGNEQDAPPNKDSLRGYGVIDSIKAQIEAVCNQTVSCADILTVAARDSVVALGGPTWTVPLGRRDSTGASAALAISDLPPFTASLQELVDAFAKKGLSVTDMVALSGAHTIGQAQCSTFRGRIYNETNIDSAFATQRQANCPRTSGDMNLAPLDTTTANAFDNAYYTNLLSNKGLLHSDQVLFNNGSTDNTVRNFASNAAEFSSAFATAMVNMGNIAPKTGTNGQIRLSCSKVNS

Retrieve as FASTA  
Remarks chromosome 7. 1 EST. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAAGCAACTTGCATTTCCTTGCTTGTGGTCGTGGCTCTGGCCACCGCGGCGTCGGCGCAGCTGTCGGCGACGTTCTACGACACGTCGTGCCCCAGAGCCATGTCCATCATCAAG
AGCGCCGTGACCGCCGCCGTGAACAGCGAACCCCGCATGGGCGCGTCGCTGCTCAGGCTGCACTTCCATGACTGTTTTGTCCAA
GCAAGTTCCACACATAACCAGCGCCTTTGTTCCATT
TTGACTTAAACGTTACTGCAGTATATCTCTAGTCAAGCAACTTGAGTGATATTTGAATTGAACTAGAAAAGTTAAATATATATTGTACATGTGTGCATGCAGTTAGATGACATGTTCAGA
CAAATAACCATATATTGTACATGTGTGCATGCAGTTAGATGACAATTGACAAGCAAGACAAATAACCATACATTCTTCCTGTTTGACTAACTGTACAGGGTTGTGACGCGTCTGTTCTGT
TGTCGGGAAACGAGCAGGATGCTCCTCCAAACAAGGATTCTCTTAGAGGCTACGGCGTCATCGACAGCATCAAGGCGCAGATAGAGGCCGTGTGCAATCAGACCGTCTCATGCGCCGACA
TCCTTACCGTCGCCGCCCGTGACTCCGTCGTCGCT
GTAAGATCACTTTCCCTGCATGCATAGCCTGCACGCTTGGTCTCGAACTCTCCTCTCGATCGATTCCTGTATGGTTGTACGTGGG
AAACGGATCCTCTAACGTGAACTTCTTCCTAACGTGATCACTAACAGTAACAGGTGAGCCCGTCAGTGGTGGAACTCATATATCAGTTATCACGTTCCTCTGGTTTTACGTCAGATGATC
CCGATCCATATATATGACATTATTAGGCTTCGGCTTTTGTACTTAACCAATGGAGTAATAATCATATGAACGCGCATGCAGCTGGGAGGGCCAACGTGGACTGTCCCGCTGGGGAGAAGG
GACTCTACAGGTGCAAGCGCGGCGCTCGCGATCAGCGACCTCCCTCCTTTTACCGCTAGCCTCCAAGAACTCGTAGACGCATTCGCCAAGAAGGGCCTTAGCGTAACCGACATGGTTGCT
CTCTCAG
GTAAAGATCCACCATATATGCTCACAAACCATCAAACCAAGCAAGCTTAATTTTCTGCACTCCTATTTCAGGCGCGCACACGATCGGGCAGGCGCAGTGCTCAACCTTCAGGG
GCAGGATCTACAACGAGACCAACATCGACTCGGCCTTCGCGACGCAACGCCAGGCCAACTGCCCACGGACATCCGGCGACATGAACCTGGCGCCGCTGGACACGACGACGGCGAACGCGT
TCGACAACGCCTACTACACCAACCTGCTGTCGAACAAGGGCCTCCTGCACTCGGACCAGGTGCTCTTCAACAACGGCAGCACGGACAACACGGTGAGGAACTTCGCGTCCAACGCGGCGG
AGTTCAGCAGCGCCTTCGCGACGGCCATGGTGAACATGGGGAACATCGCGCCCAAGACGGGAACAAACGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAAGCAACTTGCATTTCCTTGCTTGTGGTCGTGGCTCTGGCCACCGCGGCGTCGGCGCAGCTGTCGGCGACGTTCTACGACACGTCGTGCCCCAGAGCCATGTCCATCATCAAG
AGCGCCGTGACCGCCGCCGTGAACAGCGAACCCCGCATGGGCGCGTCGCTGCTCAGGCTGCACTTCCATGACTGTTTTGTCCAA
GGTTGTGACGCGTCTGTTCTGTTGTCGGGAAACGAG
CAGGATGCTCCTCCAAACAAGGATTCTCTTAGAGGCTACGGCGTCATCGACAGCATCAAGGCGCAGATAGAGGCCGTGTGCAATCAGACCGTCTCATGCGCCGACATCCTTACCGTCGCC
GCCCGTGACTCCGTCGTCGCT
CTGGGAGGGCCAACGTGGACTGTCCCGCTGGGGAGAAGGGACTCTACAGGTGCAAGCGCGGCGCTCGCGATCAGCGACCTCCCTCCTTTTACCGCTAGC
CTCCAAGAACTCGTAGACGCATTCGCCAAGAAGGGCCTTAGCGTAACCGACATGGTTGCTCTCTCAG
GCGCGCACACGATCGGGCAGGCGCAGTGCTCAACCTTCAGGGGCAGGATCTAC
AACGAGACCAACATCGACTCGGCCTTCGCGACGCAACGCCAGGCCAACTGCCCACGGACATCCGGCGACATGAACCTGGCGCCGCTGGACACGACGACGGCGAACGCGTTCGACAACGCC
TACTACACCAACCTGCTGTCGAACAAGGGCCTCCTGCACTCGGACCAGGTGCTCTTCAACAACGGCAGCACGGACAACACGGTGAGGAACTTCGCGTCCAACGCGGCGGAGTTCAGCAGC
GCCTTCGCGACGGCCATGGTGAACATGGGGAACATCGCGCCCAAGACGGGAACAAACGGCCAGATCAGGCTCAGCTGCTCCAAGGTGAACTCGTAA

Retrieve as FASTA