Entry information : OsPrx115
Entry ID 1125
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx115
Name OsPrx115
Class Class III peroxidase    [Orthogroup: Prx133]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx115
start..stop
S start..stop
SiPrx127 523 0 23..321 24..321
ZmPrx56 515 0 6..321 11..323
BdiPrx04 491 8e-177 1..321 1..324
SbPrx49 481 6e-173 1..321 7..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28638786..28638992 207 N° 2 28638490..28638684 195 N° 3 28637242..28637805 564  
complement(join(28637242..28637805,28638490..28638684,28638786..28638992))


exon

Literature and cross-references OsPrx115
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XIW9
DNA ref. GenBank:   NC_008400.1 (28638992..28637245)
Protein sequence: OsPrx115
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   34228.5 (32289.5)  
PI (pH):   %s   3.97 (3.97) Peptide Signal:   %s   cut: 21 range:21-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPFLVVFAVMAAAFASASGSGELTPDFYSETCPQALTTIKLVVGAAILKEPRMGASLVRMHFHDCFVNGCDGSVLLDDTDDMIGEKLAKPNNMSLRGFDVIDAIKVAVNTACLGNVVSCADILAVAARDSIVALGGSSYEVLLGRRDATTASIDDANDDIPNPFMDLPDLVDNFESHGLSLQDLVVLSGGHTLGYSRCLFFRSRLYNETDTLDPAYAAALEEQCPIVGDDEALASLDDTPTTVDTDYYQGLTQGRALLHTDQQLYQGGGGGDSDELVKYYGENPDKFWEDFGAAMVKMGNISPLTGDDGEIRENCRVVNQ*

Retrieve as FASTA  
Remarks chromosome 7. 6 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCATTTCTTGTTGTGTTCGCCGTCATGGCCGCGGCTTTTGCGTCGGCCTCCGGCTCCGGCGAGCTCACCCCGGACTTCTACAGCGAGACGTGCCCGCAGGCGCTGACGACCATC
AAGCTCGTCGTCGGCGCCGCCATCTTGAAGGAGCCGAGGATGGGCGCGTCCTTGGTCCGGATGCACTTCCATGACTGCTTCGTCAAT
GTGAGCTAGCTACTAAATCATGCACGCTTCAAC
TTAGTGGTTAATTGCTGCAGATTTTACAAGCAGATGAGATGTTTTGGTGATGAACGAACGTGATGCAGGGTTGTGATGGCTCCGTTCTGCTGGACGACACCGACGACATGATCGGGGAGA
AGCTGGCGAAGCCGAACAACATGTCATTGAGAGGGTTCGACGTGATCGACGCCATCAAGGTGGCGGTGAACACGGCCTGCTTGGGGAATGTTGTCTCCTGCGCTGATATCTTGGCAGTTG
CTGCTCGTGATTCAATCGTCGCG
GTAAGTTCAGTACAAGTGTAAAACTTATCCACGTTACACATACTGTCGATTGAAAGGTACTACTAGTAGTAGAAAGCTATCTATCGAACAGGGCAAC
GTCATCGACCATAAGACAAACCATGCTCCTTTTGAAAATCTTTCTTCAACCTAAACCCAATAACCGGCTTTCATGACATCATTTTCACAAGAGAATGAGTCGTGATTCACTTATCTGAAA
AACTGCGGCACATCCTGATCCTGTTGACTTGGTGAGGCCAAAATGAGGGTTTATTTAGTTGGCAAAAAAATTTGCCCCTGCATGTCACATCGGATATATAGATATATATTTGAAGTATTA
AACGTAGTCTAATACTCCATCCATCGTAAAATATAAGGCACAACCACTTTTACGTATTGTAGATTATGTCAGGAAACTGCGAGACGAATTTATTAATCCTAATTAATCCGTCATCAGCAA
ATATTTATTGTAGCACAACATTGTCAAATCATGACGCGATTAGACTTAAAAGATTCGTCTCATAATTTTCTGGCGAACTATGTAACTGATTTTTTTTACATTTAATACTACATACATATG
TCAAACATTTAATGTGACAGCACGAAAAATTTTGTTTGGGAGTTTAGGGAACTAAACAGACCCTGATGTCAATGCAACGTGACACGTACGATTCATTTTGTTTGCAGCTCGGGGGAAGCT
CGTACGAGGTGCTCCTGGGGCGGCGCGACGCGACGACGGCGAGCATCGACGACGCGAACGACGACATCCCGAACCCGTTCATGGACCTCCCGGACCTCGTCGACAACTTCGAGTCCCACG
GCTTGTCGCTGCAGGACCTCGTCGTGCTCTCCGGCGGCCACACGCTGGGCTACTCCCGCTGCCTCTTCTTCCGCAGCCGCCTCTACAACGAGACCGACACGCTGGACCCGGCCTACGCCG
CGGCGCTCGAGGAGCAGTGCCCCATCGTCGGCGACGACGAGGCGCTCGCCTCGCTGGACGACACGCCGACCACCGTGGACACCGACTACTACCAGGGCCTCACGCAGGGCCGCGCGCTGC
TGCACACGGACCAGCAGCTGTACCAGGGCGGCGGCGGCGGCGACAGCGACGAGCTGGTCAAGTACTACGGCGAGAACCCGGACAAGTTCTGGGAGGACTTCGGCGCCGCCATGGTGAAGA
TGGGCAACATCAGCCCGCTCACCGGCGACGACGGCGAGATCAGGGAGAACTGCCGGGTTGTTAACCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCATTTCTTGTTGTGTTCGCCGTCATGGCCGCGGCTTTTGCGTCGGCCTCCGGCTCCGGCGAGCTCACCCCGGACTTCTACAGCGAGACGTGCCCGCAGGCGCTGACGACCATC
AAGCTCGTCGTCGGCGCCGCCATCTTGAAGGAGCCGAGGATGGGCGCGTCCTTGGTCCGGATGCACTTCCATGACTGCTTCGTCAAT
GGTTGTGATGGCTCCGTTCTGCTGGACGACACC
GACGACATGATCGGGGAGAAGCTGGCGAAGCCGAACAACATGTCATTGAGAGGGTTCGACGTGATCGACGCCATCAAGGTGGCGGTGAACACGGCCTGCTTGGGGAATGTTGTCTCCTGC
GCTGATATCTTGGCAGTTGCTGCTCGTGATTCAATCGTCGCG
CTCGGGGGAAGCTCGTACGAGGTGCTCCTGGGGCGGCGCGACGCGACGACGGCGAGCATCGACGACGCGAACGACGAC
ATCCCGAACCCGTTCATGGACCTCCCGGACCTCGTCGACAACTTCGAGTCCCACGGCTTGTCGCTGCAGGACCTCGTCGTGCTCTCCGGCGGCCACACGCTGGGCTACTCCCGCTGCCTC
TTCTTCCGCAGCCGCCTCTACAACGAGACCGACACGCTGGACCCGGCCTACGCCGCGGCGCTCGAGGAGCAGTGCCCCATCGTCGGCGACGACGAGGCGCTCGCCTCGCTGGACGACACG
CCGACCACCGTGGACACCGACTACTACCAGGGCCTCACGCAGGGCCGCGCGCTGCTGCACACGGACCAGCAGCTGTACCAGGGCGGCGGCGGCGGCGACAGCGACGAGCTGGTCAAGTAC
TACGGCGAGAACCCGGACAAGTTCTGGGAGGACTTCGGCGCCGCCATGGTGAAGATGGGCAACATCAGCCCGCTCACCGGCGACGACGGCGAGATCAGGGAGAACTGCCGGGTTGTTAAC
CAGTGA

Retrieve as FASTA