Entry information : OsPrx119
Entry ID 1129
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx119
Name OsPrx119
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx119
start..stop
S start..stop
BdiPrx111 483 2e-173 1..333 1..335
ZmPrx80 464 6e-166 1..333 1..337
SbPrx104 459 4e-164 1..333 1..336
SiPrx64 456 1e-162 1..333 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26542255..26542488 234 N° 2 26540804..26540995 192 N° 3 26540012..26540587 576  
complement(join(26540012..26540587,26540804..26540995,26542255..26542488))


exon

Literature and cross-references OsPrx119
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6YZD5
DNA ref. GenBank:   NC_008401.1 (26542488..26540015)
Protein sequence: OsPrx119
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (302)
PWM (Da):   %s   35571.64 (32361.0) Transmb domain:   %s   i9-31o
PI (pH):   %s   5.43 (4.89) Peptide Signal:   %s   cut: 32 range:32-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERRRRSPCAAVVMAAVAMLAVMPAFPGVAADLSAGYYSSSCPKLESIVRYEVSRKINETVVTIPAVLRLFFHDCLVTGCDASALISSPNDDAEKDAPDNMSLAGDGFDTVNRVKTAVEKACPGVVSCADILALAARDVVSLASGPWWSVELGRLDGLVSKASDVDGKLPGPDMRVTKLAAVFDKHGLSMRDMVALSGAHTVGFAHCTRFTGRLYNYSAGEQTDPSMNKDYAAQLMEACPRDVGKTIAVNMDPVSPIVFDNVYYSNLVNGLGLFTSDQVLYTDGASRRTVEEFAVNQTAFFDAFVSSMVRLGRLGVKAGKDGEVRRDCTAFNH*

Retrieve as FASTA  
Remarks chromosome 8. 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAAGGAGAAGAAGCCCGTGCGCCGCCGTCGTGATGGCGGCGGTGGCAATGCTCGCCGTAATGCCGGCGTTCCCCGGCGTGGCGGCGGACTTGTCGGCGGGGTACTACAGCTCG
TCGTGCCCCAAGCTGGAGTCCATCGTGCGGTATGAGGTGTCGAGGAAGATCAACGAGACGGTCGTCACCATCCCGGCCGTCCTCAGGCTCTTCTTCCACGACTGCCTCGTCACG
GTGAGT
TCGATCAGTTCATCATCCTGGATCAAACCATTCAAACTGTTAATTAACCAATCACACAAGCAAATGCTAGTAGGCTGCATCAATCAAATCAATCTGGTTCTTGCTCGAGCCTCTCATGCA
TCTGAATGAGCATCATTTGCATTAACTGGGTTTATTCATGATTCATCTGTTGGTTTCTGGAGTCAGTTTTAAGTAAGTAGATTCTTGTTAAATTAGTTGGTTCGATGGTCGGTTCTTCAC
CTGTTCAACTTGCTGGAGCTTTGGAATCATTTTCCTGTCCTCTCTTAATCCAGAAGCCACTCCATTTCCAACGGTGCAAGGCTGCAACTTGCCGCTGCTATGCTTTTCCAGTGGCAGCTT
TGGAGCCCTGTGGCTGTACCCCAATCTTCCTCCCCATTGGCCATTCTCTCTCAAATGATTTTCTTTTTACTGAGAGGTGTTCAGATATCTGCAATTAGAAGAAAAAAATCAGGTAATTTG
TTTAGGTGGGTCGAGCTGGGAGAAGGTAGAGAGATTAGAGAAGAGAACAACTCGATTACCTCGCTCGCGTGGTCGTCGGTTGCGGCAGCGATGCATGTGACGACGCGACTTTTCATCAGT
GACGCGCATTATCAAATTGCGGCCGTGTCGGATCCATCCATCTCATTCTCCTCTCCCACTTTGCTCTTCAGAATCTTCAGAACCAGCAATCAATTCATCTGAAAAAAAAACAAGGAGAAA
GAGGCATATTAGTATTAATCCAGTCACTAAATAGTATAATTAGTAAAAGGTTTTAAAGTTTAAGAAAAATCAACTAGCCTTCTTTCTTCAAAGGTAGAGGTACCAATCAACATTTTCAGT
GCAGGGTTATAGAGTAGTATTAATTAGTTGAATGCTCCCTAAAATACTGTTACTAGTTCAGCGAGTGAAGAATAAAGATTAAAGAGATGCCTGACATGTCACGCGCTTAATGATGTTTAG
TGGTGTCCTGGCAATCAATCAGCTGGCATCTCGTCTTTTCCCTTTTGATGTTTCGAAGAACATTTTTCCTTTTGGGTTTGACCACATATAGGAATAAGATGCAGCGCGTGAATGCACGTA
GAGCACCAGTTGTATCGGCCCCACCCGGTAGCCTATACATGAACGAGCTAATATATAGTTTAACTTTCTAATTGTATAAAATAATTATAAACAGCAACTTGGAAGTAGAAATGCAGAAAG
AATCATTGTGGTTTACACTATTGAATAAAAACTGAGTAAAAAGATTTTTACAGGGGTGTGACGCTTCGGCCTTGATTTCGTCCCCAAATGACGACGCCGAGAAGGACGCGCCGGACAACA
TGTCCCTCGCCGGCGACGGCTTCGACACCGTGAACCGTGTCAAGACCGCCGTCGAGAAGGCCTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCAGAGACGTCGTCT
CCCTC
GTAAGCCTCTGCACCTCAAATCACTTCCAGAAGCTCTCACTCTGACAATCGCCATAGTACATGATCCTCTGCAGTCGACTTCACCGTGCCTTTGTCATTGACATGTGAGCCGACG
ACACATCGGGCCTACATGTCAGTGATAAAGACACGATGCAGTGACTAGAGAGGATCCTGATCCCTTACAAGTATACTGACAATGGCCACCATCAACCACAGGCGTCCGGGCCATGGTGGT
CCGTGGAGCTCGGCCGGCTGGACGGCCTCGTGTCCAAGGCGAGCGACGTCGACGGCAAGCTGCCCGGGCCGGACATGCGCGTGACGAAGCTCGCCGCCGTGTTCGACAAGCACGGGCTGT
CGATGCGCGACATGGTGGCGCTCTCCGGCGCGCACACCGTCGGCTTCGCGCACTGCACCCGCTTCACCGGCCGGCTGTACAACTACAGCGCCGGCGAGCAGACGGACCCGTCCATGAACA
AGGACTACGCGGCGCAGCTGATGGAGGCGTGCCCGCGCGACGTCGGCAAGACCATCGCCGTCAACATGGACCCCGTCAGCCCCATCGTCTTCGACAACGTCTACTACTCCAACCTCGTCA
ATGGCCTCGGCCTCTTCACCTCCGACCAGGTGCTCTACACCGACGGCGCGTCGCGGCGCACCGTCGAGGAGTTCGCCGTCAACCAGACCGCCTTCTTCGATGCCTTCGTGAGCTCCATGG
TCAGGCTGGGGAGGCTAGGGGTCAAGGCCGGCAAGGATGGAGAGGTCAGGAGAGACTGCACTGCATTCAACCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAAGGAGAAGAAGCCCGTGCGCCGCCGTCGTGATGGCGGCGGTGGCAATGCTCGCCGTAATGCCGGCGTTCCCCGGCGTGGCGGCGGACTTGTCGGCGGGGTACTACAGCTCG
TCGTGCCCCAAGCTGGAGTCCATCGTGCGGTATGAGGTGTCGAGGAAGATCAACGAGACGGTCGTCACCATCCCGGCCGTCCTCAGGCTCTTCTTCCACGACTGCCTCGTCACG
GGGTGT
GACGCTTCGGCCTTGATTTCGTCCCCAAATGACGACGCCGAGAAGGACGCGCCGGACAACATGTCCCTCGCCGGCGACGGCTTCGACACCGTGAACCGTGTCAAGACCGCCGTCGAGAAG
GCCTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCAGAGACGTCGTCTCCCTC
GCGTCCGGGCCATGGTGGTCCGTGGAGCTCGGCCGGCTGGACGGCCTCGTGTCC
AAGGCGAGCGACGTCGACGGCAAGCTGCCCGGGCCGGACATGCGCGTGACGAAGCTCGCCGCCGTGTTCGACAAGCACGGGCTGTCGATGCGCGACATGGTGGCGCTCTCCGGCGCGCAC
ACCGTCGGCTTCGCGCACTGCACCCGCTTCACCGGCCGGCTGTACAACTACAGCGCCGGCGAGCAGACGGACCCGTCCATGAACAAGGACTACGCGGCGCAGCTGATGGAGGCGTGCCCG
CGCGACGTCGGCAAGACCATCGCCGTCAACATGGACCCCGTCAGCCCCATCGTCTTCGACAACGTCTACTACTCCAACCTCGTCAATGGCCTCGGCCTCTTCACCTCCGACCAGGTGCTC
TACACCGACGGCGCGTCGCGGCGCACCGTCGAGGAGTTCGCCGTCAACCAGACCGCCTTCTTCGATGCCTTCGTGAGCTCCATGGTCAGGCTGGGGAGGCTAGGGGTCAAGGCCGGCAAG
GATGGAGAGGTCAGGAGAGACTGCACTGCATTCAACCACTAG

Retrieve as FASTA