Entry information : OsPrx120
Entry ID 1130
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx120
Name OsPrx120
Class Class III peroxidase    [Orthogroup: Prx098]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx120
start..stop
S start..stop
OsPrx121 608 0 4..331 3..328
SiPrx158 494 9e-178 1..331 1..329
SbPrx11 488 1e-175 26..331 26..330
SbPrx09 482 5e-173 12..331 14..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9439463..9439693 231 N° 2 9438617..9439381 765  
complement(join(9438617..9439381,9439463..9439693))


exon

Literature and cross-references OsPrx120
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1H3
DNA ref. GenBank:   NC_008402.1 (9439693..9438620)
Protein sequence: OsPrx120
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (303)
PWM (Da):   %s   35339.21 (32706.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.76 (8.61) Peptide Signal:   %s   cut: 29 range:29-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIMTRVATAALMVAAAVLLGLAGAGHAQLQNGFYKGKCGANDVEAVVQGIVRSRFARDAPIVAYLLRMQFHECAVNGCDGGLLIDGPGTEKTASPNLSVKGYDLIADIKAELERRCPGVVSCSDIQILATRDAVALAGGRPYAVRTGRRDRRQSRASDVVLPAPDSTAAQSVAFFRKLGLSEFDAVLLLGAHTVGATHCGVIKDSRLYKYGGRAGATDPALDPYYAFVYKTWVCPNAAASDGNVVFLDDQWSALRVDSNYYKQLQRRRGVLPCDQNLYGDGASTKWIVNLLANNSDLFPSLFPQALIKLGEVNVITGAQGEIRKVCSKFN*

Retrieve as FASTA  
Remarks chromosome 9. 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCATGACGAGGGTGGCGACGGCGGCGCTAATGGTGGCGGCCGCCGTACTGCTGGGGCTCGCCGGCGCCGGCCACGCGCAGCTGCAGAACGGGTTCTACAAGGGCAAGTGCGGC
GCCAACGACGTGGAGGCGGTGGTGCAGGGCATCGTCCGTTCACGCTTCGCCCGCGACGCCCCCATCGTCGCCTACCTCCTGCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GTACGTGGT
GCACAGCACAGCTGCTCGGATGATTGGTGTGATCGTGGCTGAAGCTGAATATATCCATGGATGATCTTGCAGGGGTGCGACGGCGGGCTGCTGATCGACGGGCCAGGCACGGAGAAGACG
GCGTCGCCGAACCTGAGCGTGAAGGGGTACGACCTCATCGCCGACATCAAGGCGGAGCTGGAGAGGCGGTGCCCCGGCGTGGTGTCCTGCTCCGACATCCAGATCCTCGCCACCCGCGAC
GCCGTCGCGCTCGCCGGCGGGCGGCCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGCCAGTCGAGGGCCTCCGACGTGGTCCTGCCGGCGCCGGACAGCACGGCGGCGCAGTCCGTC
GCCTTCTTCCGCAAGCTCGGGCTGAGCGAGTTCGACGCGGTGCTCCTCCTGGGCGCGCACACCGTCGGCGCCACGCACTGCGGCGTGATCAAGGACAGCCGGCTGTACAAGTACGGCGGC
CGCGCCGGCGCGACGGACCCGGCGCTGGACCCGTACTACGCGTTCGTGTACAAGACGTGGGTGTGCCCCAACGCGGCGGCGTCCGACGGCAACGTCGTCTTCCTCGACGACCAGTGGAGC
GCGCTGCGGGTGGACAGCAACTACTACAAGCAGCTGCAGCGCCGCCGCGGCGTGCTCCCCTGCGACCAGAACCTCTACGGCGACGGCGCCTCGACGAAGTGGATCGTCAACCTGCTCGCC
AACAACTCCGACCTCTTCCCGTCGCTCTTCCCGCAGGCGCTCATCAAGCTCGGCGAGGTCAACGTGATCACCGGAGCTCAGGGAGAGATCCGCAAGGTCTGCAGCAAGTTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCATGACGAGGGTGGCGACGGCGGCGCTAATGGTGGCGGCCGCCGTACTGCTGGGGCTCGCCGGCGCCGGCCACGCGCAGCTGCAGAACGGGTTCTACAAGGGCAAGTGCGGC
GCCAACGACGTGGAGGCGGTGGTGCAGGGCATCGTCCGTTCACGCTTCGCCCGCGACGCCCCCATCGTCGCCTACCTCCTGCGCATGCAGTTCCACGAGTGCGCCGTCAAT
GGGTGCGAC
GGCGGGCTGCTGATCGACGGGCCAGGCACGGAGAAGACGGCGTCGCCGAACCTGAGCGTGAAGGGGTACGACCTCATCGCCGACATCAAGGCGGAGCTGGAGAGGCGGTGCCCCGGCGTG
GTGTCCTGCTCCGACATCCAGATCCTCGCCACCCGCGACGCCGTCGCGCTCGCCGGCGGGCGGCCGTACGCGGTGCGCACGGGGCGGAGGGACCGCCGCCAGTCGAGGGCCTCCGACGTG
GTCCTGCCGGCGCCGGACAGCACGGCGGCGCAGTCCGTCGCCTTCTTCCGCAAGCTCGGGCTGAGCGAGTTCGACGCGGTGCTCCTCCTGGGCGCGCACACCGTCGGCGCCACGCACTGC
GGCGTGATCAAGGACAGCCGGCTGTACAAGTACGGCGGCCGCGCCGGCGCGACGGACCCGGCGCTGGACCCGTACTACGCGTTCGTGTACAAGACGTGGGTGTGCCCCAACGCGGCGGCG
TCCGACGGCAACGTCGTCTTCCTCGACGACCAGTGGAGCGCGCTGCGGGTGGACAGCAACTACTACAAGCAGCTGCAGCGCCGCCGCGGCGTGCTCCCCTGCGACCAGAACCTCTACGGC
GACGGCGCCTCGACGAAGTGGATCGTCAACCTGCTCGCCAACAACTCCGACCTCTTCCCGTCGCTCTTCCCGCAGGCGCTCATCAAGCTCGGCGAGGTCAACGTGATCACCGGAGCTCAG
GGAGAGATCCGCAAGGTCTGCAGCAAGTTCAACTAA

Retrieve as FASTA