Entry information : OsPrx123
Entry ID 1133
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx123
Name OsPrx123
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx123
start..stop
S start..stop
SbPrx32 520 0 31..331 31..336
SiPrx123 515 0 31..331 28..329
ZmPrx29 515 0 31..331 30..335
TaPrx13 491 1e-176 26..331 25..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19381742..19381975 234 N° 2 19380380..19380571 192 N° 3 19379716..19380285 570  
complement(join(19379716..19380285,19380380..19380571,19381742..19381975))


exon

Literature and cross-references OsPrx123
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1H0
DNA ref. GenBank:   NC_008402.1 (19381975..19379719)
Protein sequence: OsPrx123
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (301)
PWM (Da):   %s   34550.55 (31751.1) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.2 (8.20) Peptide Signal:   %s   cut: 31 range:31-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERRGSLYGVAAAAAVVVVVAMAAAAGGEAARLSPEHYRSTCPGVESVVRSVVARKVKETFVTVPATLRLFFHDCFVEGCDASVMIASRGNDAEKDSPDNLSLAGDGFDTVVRAKAAVEKKCPGVVSCADILAIAARDVVAMSSGPRWTVELGRLDGLVSKSGGVAGKLPGPDMRVKDLAAIFAKNNLTVLDMVALSGAHTVGFAHCTRFAGRLYGRVGGGVDPSYDPAYARQLMAACPRDVAPTIAVNMDPITPAAFDNAYYANLAGGLGLFTSDQELYTDAASRPAVTGFAKNQTLFFEAFKEAMVKLGRVGVKSGKHGEIRRDCTAFN*

Retrieve as FASTA  
Remarks chromosome 9. 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGACGTGGTAGCCTGTACGGCGTCGCGGCGGCGGCGGCGGTGGTGGTGGTGGTGGCAATGGCGGCGGCGGCCGGCGGCGAGGCGGCGAGGCTGTCGCCGGAGCACTACCGGTCG
ACGTGCCCCGGCGTGGAGTCCGTCGTGCGGTCGGTGGTGGCGAGGAAGGTGAAGGAGACCTTCGTCACCGTCCCGGCCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GTGAGC
AGCGGCGGCTGGCACTGACCCAACCAACCCTCGTGTTCTTGATTCAGATTTCAAACCGGAATTGGAGGCGTCAGAGTTTCAGAGTCGCACTTGCACCCTCAGATTTTCTGGTTCTAGGTT
TCTTGATTTCTTTCGTAATTGATAGCCTCGGTTTGATTTCGGCGAGTAGTTAGCTTTGCATTTGGCATTTGAAAATCCTTGCAAAATTTTCGCAGCTTTTGCAGCTTCAGAGCTGCTTGT
GATGCACTGAATTTTTCAGCATTACTCTGCATTAGGCATTTGCATACTTGCAAAGCTTACAAACTTTTCAGCTGCTTTCCTGATGCATTCAGGATTCAGCTTAGCAGCATGAGCAGCATG
AGGGTCTCTGAATTTTCAGCATTAATCTACATTTAATTGCATCAGAGATCATGTCAAAATTTGGTTTGTTAGTCTCAGGGAAAGGAGAGAAAAGCTACTTCCTCCGTTTCACAATATAAG
TCATTTTAACTTTCCTCATATTCATATTCATGTTAATGAATCTAGATAAATATATATATGTCTAGATTCATTAATATCAATATAAATGTAGGAAATGATAGAATGACTTGCATTATGAAA
CGGAGGGAGTAGTAGTACGAGATAATGAGAGATTAACAGTAGATTAATGGTACGAAATGGCAACTGGATTAGCTCCAAATCACGCACTCGTCGCTTCTGCCATGTGACTGCACGACCCTT
TTCTGTCAACTGGGCTGCGTAATCAAATGCTCACGACAGATGCTTCTCTGAATCCCTGCTGGAATACCAGGCGCCACGTTGTCGTATCCGATGTGGCGGACACGGAATTCCGTGCCGTCC
ACGTCATCATTCCTCCCATTTCATGATGATTTCATACTCCGGGTTATTTAGATCGATGTCATTTCAAACCATATTTTTTTATAAAGTTGTTAAATATATACTTCCATTTATTTCTTTATC
AAACTCCAGTAAATACATAAGAAATCATACAAAAATTTGATAATATTGTTAAAATTTGGTAAGGTTTATTTTGGCTTCAGTTTAAACAGACCTTTAAATTTTTGATAGGTGTGCAAATGC
TTTGATCACTTTGAAAATTGAAGTTACGTACGTTTTCAATTGGCACTGAAATTATTTTGGGGGAATTTTAACCTTTTCTGACAGGGGTGTGACGCGTCGGTCATGATCGCGTCGCGGGGC
AACGACGCCGAGAAGGACTCGCCGGACAACCTGTCGCTCGCCGGCGACGGCTTCGACACGGTGGTGCGCGCCAAGGCGGCGGTCGAGAAGAAGTGCCCCGGCGTGGTCTCCTGCGCCGAC
ATCCTCGCCATCGCCGCCAGGGACGTCGTCGCCATG
GTAAACCATCCCATCAATCCTCCTCCTCCTGCCATGGCGAAAGCTTTGCTGCCTCTAACAAGGTCGATCAATCAATCAATCAAT
GGCGTTGCAGTCGTCCGGCCCACGCTGGACCGTCGAGCTTGGCCGGCTAGACGGCCTCGTCTCCAAGTCCGGCGGCGTCGCCGGCAAGCTGCCAGGCCCGGACATGCGCGTCAAGGACCT
CGCCGCCATATTCGCCAAGAACAACCTCACCGTGCTCGACATGGTGGCGCTCTCCGGCGCGCACACCGTCGGCTTCGCGCACTGCACGCGCTTCGCCGGCCGGCTGTACGGCCGCGTCGG
CGGCGGCGTGGACCCGTCCTACGACCCGGCGTACGCGCGGCAGCTGATGGCGGCGTGCCCGCGCGACGTCGCGCCGACCATCGCCGTCAACATGGACCCCATCACCCCGGCCGCCTTCGA
CAACGCCTACTACGCCAACCTCGCCGGCGGCCTCGGCCTGTTCACCTCCGACCAGGAGCTCTACACCGACGCCGCGTCGCGGCCGGCGGTGACCGGCTTCGCCAAGAACCAGACGCTCTT
CTTCGAGGCGTTCAAGGAGGCCATGGTCAAGCTTGGCAGGGTCGGAGTCAAGTCCGGGAAGCATGGAGAGATCAGAAGAGACTGCACAGCTTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGACGTGGTAGCCTGTACGGCGTCGCGGCGGCGGCGGCGGTGGTGGTGGTGGTGGCAATGGCGGCGGCGGCCGGCGGCGAGGCGGCGAGGCTGTCGCCGGAGCACTACCGGTCG
ACGTGCCCCGGCGTGGAGTCCGTCGTGCGGTCGGTGGTGGCGAGGAAGGTGAAGGAGACCTTCGTCACCGTCCCGGCCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GGGTGT
GACGCGTCGGTCATGATCGCGTCGCGGGGCAACGACGCCGAGAAGGACTCGCCGGACAACCTGTCGCTCGCCGGCGACGGCTTCGACACGGTGGTGCGCGCCAAGGCGGCGGTCGAGAAG
AAGTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACGTCGTCGCCATG
TCGTCCGGCCCACGCTGGACCGTCGAGCTTGGCCGGCTAGACGGCCTCGTCTCC
AAGTCCGGCGGCGTCGCCGGCAAGCTGCCAGGCCCGGACATGCGCGTCAAGGACCTCGCCGCCATATTCGCCAAGAACAACCTCACCGTGCTCGACATGGTGGCGCTCTCCGGCGCGCAC
ACCGTCGGCTTCGCGCACTGCACGCGCTTCGCCGGCCGGCTGTACGGCCGCGTCGGCGGCGGCGTGGACCCGTCCTACGACCCGGCGTACGCGCGGCAGCTGATGGCGGCGTGCCCGCGC
GACGTCGCGCCGACCATCGCCGTCAACATGGACCCCATCACCCCGGCCGCCTTCGACAACGCCTACTACGCCAACCTCGCCGGCGGCCTCGGCCTGTTCACCTCCGACCAGGAGCTCTAC
ACCGACGCCGCGTCGCGGCCGGCGGTGACCGGCTTCGCCAAGAACCAGACGCTCTTCTTCGAGGCGTTCAAGGAGGCCATGGTCAAGCTTGGCAGGGTCGGAGTCAAGTCCGGGAAGCAT
GGAGAGATCAGAAGAGACTGCACAGCTTTCAACTGA

Retrieve as FASTA