Entry information : EgrPrx191
Entry ID 11352
Creation 2012-10-23 (Qiang Li)
Last sequence changes 2016-03-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-13 (Achraf Jemmat)
Peroxidase information: EgrPrx191
Name EgrPrx191
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx191
start..stop
S start..stop
EglPrx191 637 0 1..317 1..317
EguPrx191 635 0 1..317 1..317
EcamPrx191 635 0 1..317 1..317
CroPrx69 512 0 1..317 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55..267 213 N° 2 911..1102 192 N° 3 1355..1903 549  
join(55..267,911..1102,1355..1903)


exon

Literature and cross-references EgrPrx191
Literature Sequenced by peroxibase team.
Protein ref. GenBank:   AHD24479.1
DNA ref. GenBank:   NW_010092448.1 (14492656..14494503)
Cluster/Prediction ref. Genebank:   104425008
Protein sequence: EgrPrx191
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (293)
PWM (Da):   %s   33964 (31548.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.19 (9.38) Peptide Signal:   %s   cut: 25 range:25-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNSSFPIVAAIIVSLLVCLTNAQLSPNFYTRTCPNVQGIVRNATTQAVRREPRMGASILRMFFHDCFVNGCDASVLLDDTATFTGEKTARPNQNSLRGFEVIDTIKSRVEAACNATVSCADILALAARDGVVQLGGPSWAVPLGRRDARTASLSGANSQIPSPFSSLATLISSFAAQGLNARDMTALSGGHAIGLARCTTFRNRIYNETNIDASFATTRRTNCPASGGDANLAPLDRTPNRFDNNYYQNLVARRGLLHSDQELFNGGSQDALVRTYSNNYRAFASDFAAAMVKMGNISPLTGRNGEIRRNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Not initialy sequenced by E.grandis sequencing project. Sequenced by Group EEP. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAGCTTCCCCATTGTCGCTGCCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGACGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GTGCGTAACTAGGATTCTTTTGCGTTC
ATTTCTAATTATTACTTCTTTCAAGAACATTTTTGGTTGCATTTTATTTGCGAAGGTTGAATTAGATTTTCTAGTCATTTAAAATATCCAGGCATGTTGATCTCGTAAAGTTGATTTTAG
TGTTGAGTATAATGTCACGTCATTTGAATAGGTGAGGTTATAACATGCCCTTTAAATATGCAGGCCCCCTCTTAAGTTGTTGGGTGGACATTTTAACATTTTATAAAATTTAGGTTTATA
TATATTTATATATTTATATATTTATACACGTGCCATATAGTGCAGATCCGTATTTTCTAAGAAGATTAGGATTAGGTACTACATTCAAAGAAGCATTGAATTTGCTTGACTCCCATTTGT
TAAGTATCCATGAAATTGACTTGGATTTTGGAGGGGCAAGAAAAGCACACGATGAGATTATATGTCCTTTCTGAACTTATTCTACTAGATGATTTAAACTAATCATCTGATCTAAGAAAA
CTTCTGCCACATGTGCTCAATCCATCACTAATCAAAAGATGAAAAAAATATGAACTCTTAATTAAGTGATAAGGTGCAAAATTGTGACCTTCTCTTTTGAAACAATCTTATCATGTATCT
CAACCTTCTTGTGTAGGGATGTGATGCATCGGTTCTTTTGGATGACACCGCTACCTTCACTGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACAC
CATTAAGTCCCGTGTTGAAGCTGCTTGCAATGCTACCGTTTCTTGCGCGGACATCCTTGCGCTCGCTGCTCGAGACGGGGTTGTCCAA
GTGAGTTTCTCATATATCATGATCATTAATAA
CTTTTTCTCCTATTTTCTCTTTAATGCATGATTTTGGTTTATATTAACTTCAAATCTCTGACCATACCAATTACATAATAGTCATCCCCTGTTTCATGATTGGATTAGTCCATATTTATG
GGATAAATTCGCAATTTTTTATACATAACATTTTTATAGAAGACTGAACATTCGCAAACATAAATTGTATAAGCTTATGCGATTGATATTGGCATTATAGTTGGGAGGACCATCGTGGGC
GGTGCCTCTAGGGCGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGCCAAATCCCATCGCCTTTCTCCAGCCTCGCCACCCTCATCTCCTCCTTCGCTGCCCAAGGCCTCAA
TGCCCGTGACATGACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGTACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAG
GACTAACTGCCCTGCCTCTGGAGGGGACGCCAACCTTGCTCCCCTCGACCGGACCCCGAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGA
TCAAGAGCTGTTCAACGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAATAACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCT
CACCGGAAGAAATGGAGAGATCAGAAGGAACTGTAGGGTGGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAGCTTCCCCATTGTCGCTGCCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGACGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GGATGTGATGCATCGGTTCTTTTGGAT
GACACCGCTACCTTCACTGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACACCATTAAGTCCCGTGTTGAAGCTGCTTGCAATGCTACCGTTTCT
TGCGCGGACATCCTTGCGCTCGCTGCTCGAGACGGGGTTGTCCAA
TTGGGAGGACCATCGTGGGCGGTGCCTCTAGGGCGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGC
CAAATCCCATCGCCTTTCTCCAGCCTCGCCACCCTCATCTCCTCCTTCGCTGCCCAAGGCCTCAATGCCCGTGACATGACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGT
ACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAGGACTAACTGCCCTGCCTCTGGAGGGGACGCCAACCTTGCTCCCCTCGACCGGACC
CCGAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGATCAAGAGCTGTTCAACGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAAT
AACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCTCACCGGAAGAAATGGAGAGATCAGAAGGAACTGTAGGGTGGTGAACTAA

Retrieve as FASTA