Entry information : AnHalPrx01 (AnHTPx1)
Entry ID 11356
Creation 2012-10-23 (Marcel Zamocky)
Last sequence changes 2012-10-23 (Marcel Zamocky)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AnHalPrx01 (AnHTPx1)
Name (synonym) AnHalPrx01 (AnHTPx1)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus niger    [TaxId: 5061 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AnHalPrx01
start..stop
S start..stop
TterHalPrx01 285 3e-97 33..265 41..273
CgHalPrx02 264 4e-89 1..246 1..238
AorHalPrx01 261 2e-88 28..242 20..233
AorHalPrx02 241 2e-80 9..242 10..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2908861..2908972 112 N° 2 2909028..2909268 241 N° 3 2909337..2909608 272 N° 4 2909677..2909849 173
join(2908861..2908972,2909028..2909268,2909337..2909608,2909677..2909849)


exon

Literature and cross-references AnHalPrx01 (AnHTPx1)
Protein ref. GenBank:   EHA18619.1 UniProtKB:   G3YGD8
DNA ref. JGI genome:   chr_8_2 (2908861..2909849)
Protein sequence: AnHalPrx01 (AnHTPx1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265 (247)
PWM (Da):   %s   29341.5 (27525.5)  
PI (pH):   %s   4.97 (4.84) Peptide Signal:   %s   cut: 19 range:19-265
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTTTLLCLAAALTQANAFPQQGAPHPLPWSPPGPNDVRAPCPMLNTLANHGYLPHNGKDITEQHTINALYNALGIEEELAVYLHQEAVTTNPAPNATTFSLNDLSRHDILEHDASLSRQDAFFGDNHDFNQTIFDETRSYWTSPIIDVKQAALSRQARVNTSMATNPNYTMSELGNSFSYGETAAYIIVLGDKEKGLVNRSRVEYLENERLPLDLGWSRAKENITFDDLSTMLQRIINATGGESEFDRELAKRGGVHVGSWRG

Retrieve as FASTA  
Remarks Complete from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAACTACTCTACTATGCCTGGCCGCGGCCCTCACTCAGGCCAATGCATTCCCACAACAAGGAGCACCACACCCACTTCCCTGGTCCCCTCCAGGCCCTAACGATGGTAGGCCA
TCCCACAGTTCACTCTCCATACCCAAGTCTAACAGAGAAATAACCAGTCCGCGCCCCCTGCCCAATGCTCAACACCCTCGCCAACCACGGCTATCTCCCCCACAACGGCAAGGACATCAC
CGAGCAACACACCATCAACGCCCTCTACAACGCTCTAGGAATCGAAGAAGAACTCGCCGTATACCTCCACCAAGAAGCAGTGACCACCAACCCCGCCCCCAACGCAACAACATTCTCCCT
GAATGACTTAAGCCGTCATGATATCCTCGAACATGATGCCAGCTTGAG
GTATGCCCTTCCCCCCGTTTACCTCCTATCCCCTCCCTCCACCTGTCTAACCATTTACCATATGATAGCCGC
CAAGACGCCTTCTTCGGCGACAACCACGACTTCAACCAAACCATCTTCGACGAGACCCGCTCATACTGGACTTCTCCCATCATCGACGTGAAGCAGGCTGCTCTGTCGCGCCAAGCGCGT
GTTAACACTTCCATGGCTACGAATCCGAATTATACGATGTCGGAGCTGGGCAACTCGTTTAGTTACGGGGAGACGGCGGCATATATTATTGTGCTGGGGGATAAGGAGAAGGGGTTGGTG
AATCGGTCCAGGGTGGAGTATCTTTTTG
GTGAGTCCAAGCCCTTTCGGGTTTCGGTGTGGTCCGTGCTGGGTTGTGTGCTGACTGATGGACTGTAGAGAATGAGCGTCTTCCGCTGGATC
TGGGGTGGAGTCGTGCGAAAGAGAATATCACGTTTGATGATTTGAGCACCATGTTGCAGAGAATTATTAATGCGACGGGTGGTGAGAGTGAGTTTGATAGGGAGTTGGCGAAAAGGGGTG
GCGTGCATGTTGGGAGTTGGAGGGGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAACTACTCTACTATGCCTGGCCGCGGCCCTCACTCAGGCCAATGCATTCCCACAACAAGGAGCACCACACCCACTTCCCTGGTCCCCTCCAGGCCCTAACGATGTCCGCGCC
CCCTGCCCAATGCTCAACACCCTCGCCAACCACGGCTATCTCCCCCACAACGGCAAGGACATCACCGAGCAACACACCATCAACGCCCTCTACAACGCTCTAGGAATCGAAGAAGAACTC
GCCGTATACCTCCACCAAGAAGCAGTGACCACCAACCCCGCCCCCAACGCAACAACATTCTCCCTGAATGACTTAAGCCGTCATGATATCCTCGAACATGATGCCAGCTTGAG
CCGCCAA
GACGCCTTCTTCGGCGACAACCACGACTTCAACCAAACCATCTTCGACGAGACCCGCTCATACTGGACTTCTCCCATCATCGACGTGAAGCAGGCTGCTCTGTCGCGCCAAGCGCGTGTT
AACACTTCCATGGCTACGAATCCGAATTATACGATGTCGGAGCTGGGCAACTCGTTTAGTTACGGGGAGACGGCGGCATATATTATTGTGCTGGGGGATAAGGAGAAGGGGTTGGTGAAT
CGGTCCAGGGTGGAGTATCTTTTTG
AGAATGAGCGTCTTCCGCTGGATCTGGGGTGGAGTCGTGCGAAAGAGAATATCACGTTTGATGATTTGAGCACCATGTTGCAGAGAATTATTAAT
GCGACGGGTGGTGAGAGTGAGTTTGATAGGGAGTTGGCGAAAAGGGGTGGCGTGCATGTTGGGAGTTGGAGGGGGTAG

Retrieve as FASTA