Entry information : OsPrx126
Entry ID 1136
Creation 2006-08-25 (Filippo Passardi)
Last sequence changes 2006-08-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx126
Name OsPrx126
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx126
start..stop
S start..stop
SiPrx159 515 0 1..326 1..326
SbPrx06 515 0 1..326 1..326
ZmPrx86 495 2e-178 1..326 1..331
ZmPrx11 485 1e-174 3..326 6..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 657628..657849 222 N° 2 657333..657515 183 N° 3 657061..657226 166 N° 4 656357..656766 410
complement(join(656357..656766,657061..657226,657333..657515,657628..657849))


exon

Literature and cross-references OsPrx126
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XHB1
DNA ref. GenBank:   NC_008403.1 (657849..656360)
Protein sequence: OsPrx126
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35476.21 (32317.7)  
PI (pH):   %s   4.45 (4.33) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEYSYSYRFMLVCSVLVLCLNTRGARCQLSDDFYDYICPDVYTVVQQHVYAAMRTEMRMGASLLRLHFHDCFVNGCDGSILLDGDDGEKFALPNKNSVRGFEVIDAIKEDLENICPEVVSCADIVALAAGYGVLFSGGPYYDVLLGRRDGLVANQSGADNGLPSPFEPIKSIIQKFNDVGLDTTDVVVLSGGHTIGRARCTLFSNRLSTTSSSADPTLDATMAANLQSLCAGGDGNETTVLDITSAYVFDNRYYQNLLNQKGLLSSDQGLFSSDDGIANTKELVETYSADAHKFFWDFGRSMVKMGNISPLTGDDGQIRKNCRVVN

Retrieve as FASTA  
Remarks chromosome 10. 19 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTTACAGCTACAGGTTCATGCTTGTATGCTCTGTTCTTGTACTGTGCCTTAATACTCGGGGTGCGAGATGCCAGTTATCCGACGATTTCTACGACTACATATGTCCTGAT
GTGTACACCGTTGTCCAGCAGCATGTTTATGCTGCCATGAGGACTGAGATGAGGATGGGTGCCTCCCTCCTAAGGCTCCATTTCCATGACTGCTTTGTCAAT
GTATACATTAACTACCCT
TTTCACACATCTCTGAACTTTATCTGAATGTTCTACATACATATTAAATTGACTAGTTGTGTCACAATTACTGAAAATTTGTTGTGCATTTCAGGGGTGTGACGGTTCCATCCTTCTGGA
CGGTGACGACGGCGAGAAATTTGCACTTCCCAACAAGAACTCTGTCAGAGGGTTCGAAGTCATTGACGCGATAAAGGAAGATCTCGAGAACATCTGCCCTGAAGTTGTTTCCTGCGCCGA
CATTGTAGCCCTTGCAGCTGGCTATGGAGTACTATTT
GTATGTTCAGTCTACGTCTACCCATTGTCCTTGTTGTTTCACTTTCTGATACTGTACATCTTTGTTTGAAAATCTCAAGTATG
CTAAAATTTCATCATTTGTTCAGAGTGGAGGCCCTTACTATGACGTTCTTCTCGGTAGAAGGGATGGTCTTGTCGCAAATCAATCAGGAGCTGACAACGGCCTCCCTTCACCGTTCGAAC
CCATCAAATCGATCATACAGAAGTTCAATGATGTCGGCCTCGACACAACCGATGTTGTCGTCCTATCAG
GTAGCACACTAGTGATCAATCCATCTCATGGTGCACGAATGGTTCAGAATC
TGGTTTATATGCTAAGATAACCTCTTCCTACACTGTAGTACTTCCTGAAACTGTACAGTGGCAGCCCATGTTTCAGGGAACATATGCTCTCTGTCAGTTCCGAATTTTCATACTGTCTAC
AGTAAAAACTTGGAAACCGTCAGAGATAATATTTGATCAATTATAAAATGATCTGTTGCACATTTCAAGATTTCATAAACTTTTAAATGATCTGGAAATCTGAAACTCATTGATCATCAA
TAGGAGGGCACACGATCGGACGAGCCCGGTGCACGCTGTTCAGCAACCGGTTGTCGACCACCTCAAGCTCAGCCGACCCGACGCTGGACGCCACCATGGCCGCCAACCTCCAGAGCCTCT
GTGCCGGTGGAGACGGCAACGAGACCACCGTGCTGGACATCACCTCCGCCTACGTTTTCGACAACCGCTACTACCAGAACCTCCTCAATCAGAAAGGCCTCCTGTCCTCCGACCAGGGCC
TCTTCTCCAGCGACGACGGCATCGCCAACACCAAGGAGCTGGTGGAGACTTACAGCGCAGATGCCCACAAGTTCTTCTGGGATTTTGGCAGATCCATGGTGAAGATGGGCAACATCAGCC
CACTCACCGGTGACGACGGCCAGATTCGCAAGAACTGCAGGGTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACTCTTACAGCTACAGGTTCATGCTTGTATGCTCTGTTCTTGTACTGTGCCTTAATACTCGGGGTGCGAGATGCCAGTTATCCGACGATTTCTACGACTACATATGTCCTGAT
GTGTACACCGTTGTCCAGCAGCATGTTTATGCTGCCATGAGGACTGAGATGAGGATGGGTGCCTCCCTCCTAAGGCTCCATTTCCATGACTGCTTTGTCAAT
GGGTGTGACGGTTCCATC
CTTCTGGACGGTGACGACGGCGAGAAATTTGCACTTCCCAACAAGAACTCTGTCAGAGGGTTCGAAGTCATTGACGCGATAAAGGAAGATCTCGAGAACATCTGCCCTGAAGTTGTTTCC
TGCGCCGACATTGTAGCCCTTGCAGCTGGCTATGGAGTACTATTT
AGTGGAGGCCCTTACTATGACGTTCTTCTCGGTAGAAGGGATGGTCTTGTCGCAAATCAATCAGGAGCTGACAAC
GGCCTCCCTTCACCGTTCGAACCCATCAAATCGATCATACAGAAGTTCAATGATGTCGGCCTCGACACAACCGATGTTGTCGTCCTATCAG
GAGGGCACACGATCGGACGAGCCCGGTGC
ACGCTGTTCAGCAACCGGTTGTCGACCACCTCAAGCTCAGCCGACCCGACGCTGGACGCCACCATGGCCGCCAACCTCCAGAGCCTCTGTGCCGGTGGAGACGGCAACGAGACCACCGTG
CTGGACATCACCTCCGCCTACGTTTTCGACAACCGCTACTACCAGAACCTCCTCAATCAGAAAGGCCTCCTGTCCTCCGACCAGGGCCTCTTCTCCAGCGACGACGGCATCGCCAACACC
AAGGAGCTGGTGGAGACTTACAGCGCAGATGCCCACAAGTTCTTCTGGGATTTTGGCAGATCCATGGTGAAGATGGGCAACATCAGCCCACTCACCGGTGACGACGGCCAGATTCGCAAG
AACTGCAGGGTTGTTAATTAA

Retrieve as FASTA