Entry information : CcorGPx01
Entry ID 11368
Creation 2012-12-12 (Christophe Dunand)
Last sequence changes 2012-12-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-12 (Christophe Dunand)
Peroxidase information: CcorGPx01
Name CcorGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx01
start..stop
S start..stop
CcorGPx02 309 3e-110 1..165 1..165
CcorGPx05 266 3e-93 1..164 1..164
CcasGPx01 234 2e-80 1..159 1..159
SmiGPx03 226 2e-77 2..159 3..160
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 70776..70850 75 N° 2 70511..70722 212 N° 3 70364..70460 97 N° 4 70192..70305 114
complement(join(70192..70305,70364..70460,70511..70722,70776..70850))


exon

Literature and cross-references CcorGPx01
DNA ref. JGI genome:   scaffold_45 (70850..70192)
Cluster/Prediction ref. JGI gene:   84340
Protein sequence: CcorGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18600.34  
PI (pH):   %s   5.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSVYDFKVKDKADQDHDLSQYKGKVILVVNTASKCGFTPQFDGLEKLYQKYKDRGFVILGFPCNQFGSQDPGSQDEIESFCKVNYGVTFPIMKKIEVNGDNTDPFWDYLKNEKSGLLGIKKIKWNFKFLIDANGNIAERYASTTTPESIDPAVEKLLPGQSSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGTTTACGATTTTAAAGTTAAAGATAAAGCTGATCAAGATCACGACTTGTCTCAGTATAAAGGAAAAGTAATACTGTACAAAATTTGCTAATTTACAAAGTTAACTTTTTTC
ATTACTAGGTCATCCTTGTTGTTAACACAGCTTCCAAGTGTGGCTTCACTCCTCAATTTGACGGTTTAGAAAAGTTATACCAAAAGTACAAAGATAGAGGCTTCGTTATTTTAGGTTTCC
CTTGTAACCAATTTGGAAGCCAAGATCCCGGTAGCCAAGACGAAATTGAAAGCTTCTGCAAAGTTAACTACGGTGTCACTTTTCCTATTATGAAAAAAAT
GTAAGCTAATACATTGTTGT
TTGACTGAATTATTTTAAAACTTTTATTAGTGAAGTTAATGGTGATAATACTGATCCATTTTGGGACTATTTAAAGAATGAAAAGAGTGGCCTGTTAGGCATTAAGAAGATTAAATGGAA
CTTTGAG
GTAATATTCAATATTAATGGGTATCTTATATTAATTATTAATAACACTTTAACTATAGAAATTCTTAATTGATGCAAATGGAAATATTGCTGAAAGATATGCCAGTACAACTA
CTCCAGAAAGTATTGACCCAGCTGTAGAAAAACTTTTACCTGGTCAATCTTCTTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGTTTACGATTTTAAAGTTAAAGATAAAGCTGATCAAGATCACGACTTGTCTCAGTATAAAGGAAAAGTCATCCTTGTTGTTAACACAGCTTCCAAGTGTGGCTTCACTCCT
CAATTTGACGGTTTAGAAAAGTTATACCAAAAGTACAAAGATAGAGGCTTCGTTATTTTAGGTTTCCCTTGTAACCAATTTGGAAGCCAAGATCCCGGTAGCCAAGACGAAATTGAAAGC
TTCTGCAAAGTTAACTACGGTGTCACTTTTCCTATTATGAAAAAAAT
TGAAGTTAATGGTGATAATACTGATCCATTTTGGGACTATTTAAAGAATGAAAAGAGTGGCCTGTTAGGCATT
AAGAAGATTAAATGGAACTTTGAG
AAATTCTTAATTGATGCAAATGGAAATATTGCTGAAAGATATGCCAGTACAACTACTCCAGAAAGTATTGACCCAGCTGTAGAAAAACTTTTACCT
GGTCAATCTTCTTTATAA

Retrieve as FASTA