Entry information : CcorGPx02
Entry ID 11369
Creation 2012-12-12 (Christophe Dunand)
Last sequence changes 2012-12-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-12 (Christophe Dunand)
Peroxidase information: CcorGPx02
Name CcorGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx02
start..stop
S start..stop
CcorGPx01 309 3e-110 1..165 1..165
CcorGPx05 280 1e-98 1..162 1..162
CcasGPx01 229 1e-78 1..159 1..159
SpuGPx01 228 1e-77 3..159 56..212
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 81959..82033 75 N° 2 82086..82297 212 N° 3 82350..82446 97 N° 4 82498..82611 114
join(81959..82033,82086..82297,82350..82446,82498..82611)


exon

Literature and cross-references CcorGPx02
DNA ref. JGI genome:   scaffold_45 (81959..82611)
Cluster/Prediction ref. JGI gene:   84343
Protein sequence: CcorGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18690.49  
PI (pH):   %s   5.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSIYDFKVKDKADQEHDLAQYKGKVVLVVNTASKCGFTPQFDGLEKLYQKYKDRGFVILGFPCNQFGSQDPGSQDEIESFCKVNYGVTFPIMKKIEVNGDNAEPFWEFLKKEKAGIMGLKRIKWNFKFLIDANGNVAERYASITTPESIESTVEKLLPAQPSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTATTTACGATTTTAAAGTTAAAGACAAAGCTGATCAAGAGCACGATTTAGCTCAATACAAGGGAAAAGTAATATCATCGTAATATTCCAAAATTCATAAAGTTAACTTTTTA
TTATTAGGTTGTTCTTGTAGTTAACACCGCTTCCAAGTGTGGCTTCACTCCTCAATTTGACGGTTTAGAAAAATTATACCAAAAGTACAAAGATAGAGGCTTCGTTATTTTAGGTTTCCC
TTGCAACCAATTTGGAAGTCAAGATCCTGGTAGTCAAGACGAAATTGAAAGCTTCTGCAAAGTTAACTATGGTGTCACCTTCCCTATTATGAAAAAGAT
GTAAGTTAACATATTACTATT
CAAGTTGATTTTACTTACAATTAAATTTTAGCGAAGTTAACGGTGATAACGCTGAACCTTTCTGGGAATTCTTAAAGAAGGAAAAGGCTGGTATTATGGGCTTAAAGAGAATTAAGTGGA
ACTTTGAA
GTAATTATCTAATTAACATAACAATCTTCAATTACTAACTTTAATCTATAGAAATTCTTAATTGATGCCAATGGAAATGTAGCTGAAAGATATGCCAGTATAACCACTCCTG
AAAGCATTGAATCAACTGTTGAAAAGCTTTTACCTGCTCAACCTTCTTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTATTTACGATTTTAAAGTTAAAGACAAAGCTGATCAAGAGCACGATTTAGCTCAATACAAGGGAAAAGTTGTTCTTGTAGTTAACACCGCTTCCAAGTGTGGCTTCACTCCT
CAATTTGACGGTTTAGAAAAATTATACCAAAAGTACAAAGATAGAGGCTTCGTTATTTTAGGTTTCCCTTGCAACCAATTTGGAAGTCAAGATCCTGGTAGTCAAGACGAAATTGAAAGC
TTCTGCAAAGTTAACTATGGTGTCACCTTCCCTATTATGAAAAAGAT
CGAAGTTAACGGTGATAACGCTGAACCTTTCTGGGAATTCTTAAAGAAGGAAAAGGCTGGTATTATGGGCTTA
AAGAGAATTAAGTGGAACTTTGAA
AAATTCTTAATTGATGCCAATGGAAATGTAGCTGAAAGATATGCCAGTATAACCACTCCTGAAAGCATTGAATCAACTGTTGAAAAGCTTTTACCT
GCTCAACCTTCTTTATAA

Retrieve as FASTA