Entry information : OsPrx127
Entry ID 1137
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx127
Name OsPrx127
Class Class III peroxidase    [Orthogroup: Prx184]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx127
start..stop
S start..stop
SbPrx13 431 3e-153 1..317 1..319
BdiPrx107 424 8e-151 19..318 16..319
ZmPrx52 423 2e-150 24..317 25..317
ZmPrx05 272 7e-91 33..314 28..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20376532..20376753 222 N° 2 20376821..20377009 189 N° 3 20377113..20377658 546  
join(20376532..20376753,20376821..20377009,20377113..20377658)


exon

Literature and cross-references OsPrx127
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8W2X3
DNA ref. GenBank:   NC_008403.1 (20376532..20377655)
Protein sequence: OsPrx127
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (292)
PWM (Da):   %s   34249.11 (31628.7) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.14 (8.99) Peptide Signal:   %s   cut: 27 range:27-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMKRGATAALWLVAAVAGMLLHADAQTLVYKYYAQKCPAAESIVFDEVQKAWNADRSMPASLLRLHFHDCFVNGCDGSVLLEASDGQAEKNAQPNLSLRGYDVVDRVKARLEATCKQTVSCADILAYAARDSVRVMTGGYKYEVPGGRPDGTVSRASMTGDLPPPKQRNVDQLARYFTSKGLTVDDMVVLSGAHTLGVARCGTFGYRLTSDGDKGMDAAFRNALRKQCNYKSNNVAALDAGSEYGFDTSYYANVLANRTVLESDAALNSPRTLARVTQLRGNQALFTSSFAAAMVKMGGLRGGYAGKVRDNCRRVRT*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, introns 1 and 2). No EST found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGAAGAGGGGAGCCACGGCCGCGCTGTGGCTGGTCGCCGCCGTCGCCGGCATGCTCCTGCACGCCGACGCGCAGACGCTCGTGTACAAGTACTACGCCCAGAAGTGCCCCGCC
GCCGAGTCCATCGTGTTCGACGAGGTCCAGAAGGCGTGGAACGCCGACCGGAGCATGCCGGCCAGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAC
GTAAGCTAAGCTAGCAAT
GGCGTCCCCGGTCGTCGCCGAGTTGATGTAACGCCGGTTTGATTTTCAGGGTTGCGACGGGTCGGTGTTGCTGGAGGCGAGCGACGGGCAGGCGGAGAAGAACGCGCAGCCGAACCTGAG
CCTGCGAGGCTACGACGTCGTCGACAGGGTGAAGGCGAGGTTGGAGGCGACGTGCAAGCAGACGGTGTCGTGCGCCGACATCCTCGCCTACGCCGCCCGCGACAGCGTCAGGGTCATG
GT
GAGAGAGCACGTCGTCCACACGCCGACATCCTCGCCTACTCACGCAGCTCAGTTGTAATCACATTCTTTCTCATCGCCGGCTGGCATTTGATGGCGTGCAGACCGGCGGCTACAAGTACG
AGGTGCCCGGCGGGAGGCCGGACGGGACGGTGTCGCGGGCGAGCATGACCGGCGACCTCCCGCCGCCGAAGCAGCGGAACGTGGACCAGCTGGCGCGGTACTTCACCAGCAAGGGCCTGA
CCGTGGACGACATGGTGGTGCTCTCCGGCGCGCACACGCTCGGCGTCGCCAGGTGCGGCACGTTCGGGTACAGGCTGACGAGCGACGGCGACAAGGGCATGGACGCCGCGTTCCGGAACG
CGCTGAGGAAGCAGTGCAACTACAAGTCCAACAACGTCGCCGCCCTCGACGCCGGCAGCGAGTACGGCTTCGACACCAGCTACTACGCCAACGTGCTCGCCAACCGCACCGTGCTCGAGT
CCGACGCCGCGCTCAACTCGCCCAGGACCTTGGCGAGGGTCACCCAGCTCAGGGGCAACCAGGCGCTGTTCACGAGCAGCTTCGCCGCCGCCATGGTCAAGATGGGCGGCCTCCGCGGCG
GCTACGCCGGCAAGGTCCGCGACAACTGCCGGCGGGTCAGGACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGAAGAGGGGAGCCACGGCCGCGCTGTGGCTGGTCGCCGCCGTCGCCGGCATGCTCCTGCACGCCGACGCGCAGACGCTCGTGTACAAGTACTACGCCCAGAAGTGCCCCGCC
GCCGAGTCCATCGTGTTCGACGAGGTCCAGAAGGCGTGGAACGCCGACCGGAGCATGCCGGCCAGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAC
GGTTGCGACGGGTCGGTG
TTGCTGGAGGCGAGCGACGGGCAGGCGGAGAAGAACGCGCAGCCGAACCTGAGCCTGCGAGGCTACGACGTCGTCGACAGGGTGAAGGCGAGGTTGGAGGCGACGTGCAAGCAGACGGTG
TCGTGCGCCGACATCCTCGCCTACGCCGCCCGCGACAGCGTCAGGGTCATG
ACCGGCGGCTACAAGTACGAGGTGCCCGGCGGGAGGCCGGACGGGACGGTGTCGCGGGCGAGCATGACC
GGCGACCTCCCGCCGCCGAAGCAGCGGAACGTGGACCAGCTGGCGCGGTACTTCACCAGCAAGGGCCTGACCGTGGACGACATGGTGGTGCTCTCCGGCGCGCACACGCTCGGCGTCGCC
AGGTGCGGCACGTTCGGGTACAGGCTGACGAGCGACGGCGACAAGGGCATGGACGCCGCGTTCCGGAACGCGCTGAGGAAGCAGTGCAACTACAAGTCCAACAACGTCGCCGCCCTCGAC
GCCGGCAGCGAGTACGGCTTCGACACCAGCTACTACGCCAACGTGCTCGCCAACCGCACCGTGCTCGAGTCCGACGCCGCGCTCAACTCGCCCAGGACCTTGGCGAGGGTCACCCAGCTC
AGGGGCAACCAGGCGCTGTTCACGAGCAGCTTCGCCGCCGCCATGGTCAAGATGGGCGGCCTCCGCGGCGGCTACGCCGGCAAGGTCCGCGACAACTGCCGGCGGGTCAGGACATGA

Retrieve as FASTA