Entry information : McirCcP01
Entry ID 11370
Creation 2012-12-13 (Christophe Dunand)
Last sequence changes 2012-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-13 (Christophe Dunand)
Peroxidase information: McirCcP01
Name McirCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Mucoraceae Mucor
Organism Mucor circinelloides    [TaxId: 36080 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value McirCcP01
start..stop
S start..stop
RoCcP03 506 0 1..272 1..270
PblCcP02 452 2e-163 3..272 2..271
UramCcP01 448 1e-161 1..272 1..271
BemeCcP 365 7e-129 1..271 1..271
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2577264..2577370 107 N° 2 2577420..2577608 189 N° 3 2577671..2577955 285 N° 4 2578013..2578250 238
join(2577264..2577370,2577420..2577608,2577671..2577955,2578013..2578250)


exon

Literature and cross-references McirCcP01
DNA ref. JGI genome:   scaffold_0 (2577264..2578250)
Cluster/Prediction ref. JGI gene:   105066
Protein sequence: McirCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   273
PWM (Da):   %s   30576.99  
PI (pH):   %s   5.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTSQASPDKYTEVRQDIAKAFPNEEYDDGSFAPVVLRLAWHASGTYDKNHKDGGSDGATMRYKAEAEDPANAGLEHARHFLDPIKAKHTWISYADLWTLAGCVAVEQMGGPHIEWTGGRRDKANETDCPPLGRLPDAALGKDHVLDVFVSRMGFTVQETVALIGAHTVGRCHADRSGFDGPWTYNPTRFSNQFYKLLLNVTWVEKKWDGPKQFVDEDEGEIMMLPTDMALLEEPFRQYVELYAKDQQKFFDDFAAAFLKLIELGVAKRSKM

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACATCCCAAGCCTCTCCCGATAAATACACTGAAGTCAGACAAGACATTGCCAAGGCATTCCCCAACGAAGAATACGACGATGGATCATTCGCTCCCGTAGTGTAAGTTTGCCAT
GATCTTTTCTTCCCAATGTCTAATCACTCCCCACAGCCTTCGTTTAGCTTGGCATGCCAGTGGCACCTACGACAAGAACCACAAGGATGGTGGCAGCGATGGTGCTACCATGCGTTACAA
GGCTGAAGCAGAGGATCCTGCCAACGCTGGTTTAGAACATGCCAGACATTTCCTCGATCCCATCAAGGCCAAGCACACCTGGATCTCATACGCTGATTTGTGGAC
GTAAGTGGTCGAATC
GGAAATCCTTAGGAAAATCATGATATTCATCCAACGTCAATCTGTAGTCTTGCTGGATGTGTTGCAGTCGAGCAAATGGGCGGTCCTCACATCGAATGGACTGGTGGCCGTCGTGATAAG
GCTAATGAGACCGATTGCCCTCCCCTTGGCCGTCTTCCCGATGCTGCTCTCGGAAAGGACCATGTGCTTGATGTCTTTGTCTCTCGCATGGGCTTCACTGTTCAAGAGACTGTTGCCTTG
ATCGGTGCTCACACTGTTGGCCGTTGTCATGCTGATCGCTCTGGCTTTGATGGCCCTTGGACCTATAACCCTACTCGTTTCTCCAACCAATT
GTAAGTATTCATGAGAATGCTTGCCTGA
TAACAGCGACTCATGTGTTTTATGTATAGCTACAAGCTTTTGCTCAATGTCACCTGGGTTGAAAAGAAGTGGGATGGCCCCAAGCAATTTGTCGACGAAGATGAGGGAGAGATCATGATG
TTGCCTACTGACATGGCACTTTTGGAAGAGCCTTTCCGCCAATACGTCGAGCTCTATGCCAAGGATCAACAAAAGTTCTTTGACGACTTTGCTGCTGCTTTCCTCAAGTTAATAGAGTTG
GGTGTCGCAAAGAGATCAAAGATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACATCCCAAGCCTCTCCCGATAAATACACTGAAGTCAGACAAGACATTGCCAAGGCATTCCCCAACGAAGAATACGACGATGGATCATTCGCTCCCGTAGTCCTTCGTTTAGCT
TGGCATGCCAGTGGCACCTACGACAAGAACCACAAGGATGGTGGCAGCGATGGTGCTACCATGCGTTACAAGGCTGAAGCAGAGGATCCTGCCAACGCTGGTTTAGAACATGCCAGACAT
TTCCTCGATCCCATCAAGGCCAAGCACACCTGGATCTCATACGCTGATTTGTGGAC
TCTTGCTGGATGTGTTGCAGTCGAGCAAATGGGCGGTCCTCACATCGAATGGACTGGTGGCCGT
CGTGATAAGGCTAATGAGACCGATTGCCCTCCCCTTGGCCGTCTTCCCGATGCTGCTCTCGGAAAGGACCATGTGCTTGATGTCTTTGTCTCTCGCATGGGCTTCACTGTTCAAGAGACT
GTTGCCTTGATCGGTGCTCACACTGTTGGCCGTTGTCATGCTGATCGCTCTGGCTTTGATGGCCCTTGGACCTATAACCCTACTCGTTTCTCCAACCAATT
CTACAAGCTTTTGCTCAAT
GTCACCTGGGTTGAAAAGAAGTGGGATGGCCCCAAGCAATTTGTCGACGAAGATGAGGGAGAGATCATGATGTTGCCTACTGACATGGCACTTTTGGAAGAGCCTTTCCGCCAATACGTC
GAGCTCTATGCCAAGGATCAACAAAAGTTCTTTGACGACTTTGCTGCTGCTTTCCTCAAGTTAATAGAGTTGGGTGTCGCAAAGAGATCAAAGATGTAA

Retrieve as FASTA