Entry information : Egu2CysPrx01
Entry ID 11377
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: Egu2CysPrx01
Name Egu2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Egu2CysPrx01
start..stop
S start..stop
Egr2CysPrx01 556 0 1..277 1..277
Egl2CysPrx01 556 0 1..277 1..277
Pt2CysPrx01 433 8e-156 1..277 1..269
Vv2CysPrx01 424 7e-152 1..277 1..273
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5777..6016 240 N° 2 6826..6900 75 N° 3 7058..7139 82 N° 4 7262..7341 80
N° 5 7852..7977 126 N° 6 8316..8429 114 N° 7 8551..8667 117  
join(5777..6016,6826..6900,7058..7139,7262..7341,7852..7977,8316..8429,8551..866 7)


exon

Literature and cross-references Egu2CysPrx01
Protein sequence: Egu2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   29729.35  
PI (pH):   %s   8.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSAASTTLISSNPASSSSSSSLAKKSLSPVMLSSPRSVAVPKSISALANPFLSSRIPRSVAPSRASNSRRSSFSVKASSELPLVGNVAPNFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEKLNTEVLGVSVDSFSHLAWIQTDRKSGGLGDLKYPLISDVTKSISKXYDVLIPDQGIALRGLFIIDKEGVIQHSTINNLAXGRSVDETLRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFAAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_11_37808 (5777..8667).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTGCTTCGACCACCCTCATCTCCTCCAACCCCGCCTCCTCCTCCTCCTCCTCCTCCTTGGCCAAGAAGTCCCTGTCCCCCGTGATGCTCTCCTCCCCCCGGAGCGTC
GCTGTCCCCAAGTCCATCTCCGCTCTCGCCAACCCCTTCCTCTCTTCTCGCATCCCCAGATCGGTCGCTCCCTCCCGCGCCTCCAATTCCAGGCGCAGCAGCTTCTCCGTCAAGGCCTCC
GTACGTNTTNNCCCAAGAAACTTAATTCGNTGTTGGTGANTGAGTGCATTTGGGTTGTCAAGATGGTAGTTTCTGGGAATTGTTTTTATGGGATTGCCGTGAATTGCTNGTTGTCGTCCT
TGANTCATAGCATTTGGGAGAGAGGAAAAAATGGTTTGAGGTTTTCTTTGTTGTTAGTGGTTTATGGTGTGATTAGCCCTGTGCTATGCGTGTGTGTTCTTTTCGGGTTGTAGTTTTATC
ACCGCTTAGGACTTATTTCAGATGAGGTTGATNCGATGCGTCCGTGCGNTACTCGGTTCTCTATCTGTCTGCTGAACTGGTCTGTAGTGATGTAGATTCCTAGTGCGAGCCTGCACAGCG
TAGTTGAGTAATCATATTNACTTTCAAATGTTGATGTCGTTGGCTAGTTGGGNCCGGCCANTTCCTACAANAATTCATAATGTGTGCNGACGTTACTGTGGAGCCAAAGGTTGTTCGTAG
AGAAATGATGAGGTTTATGGTTCTGTGTTCTTGATCATTTGAAGCACACTTCTGNCTGGCTGCCTGTAAATCTCAATTGGAGCTCACGGGCTGAGTGTAGAACTCAATGAGATCGCCAGA
ACCTCCTAAANCTATTCACGTGTGATTGTTTTTCCATGACCCTTGTCNTTGACTNGATCAGAATTCCNGAACTTGACACAAACTTCCAAACTTCNCCCTTNATTGTGCTCCTGTTTACTT
TGTNATACTTNTTGACCATGTCATTGATTTTCACTTTTTATGTTCAATTTGTATTCAAACTGAATGTATCATCTCACATCTTTGTTCAGAGTGAGCTTCCCCTTGTTGGAAATGTAGCAC
CAAATTTCGAGGCAGAGGCTGTCTTTGATCAGGAGTTCATCAAT
GTAGGTTATTCAATTCAGGACTTCGTAAAGTCTGCAAGCATTNTTATTGGTTTTTTACAGTCACAACTTGATATCT
AACAGATTGATTCCTGGAGAATCAAATATGCAGCCTCTCATGAAGGTTCTTCTTAGTTTGCATATGTATTCTGCATTTCAGGTTAAGCTGTCAGATTACATTGGGAAGAAATATGTGATT
CTCTTCTTCTACCCATTAGACTTCACTTTTGTCTGCCCAACAG
GTTAGATGCTGAAGCATAGAAGTGCTTCTTAATCTCTGCAATATATTTAGTTTAATATAATTTGGTTTGTTTGGGTG
TAACATGATGTTTACAATTAACTAAGTTTTCTCTTCTTCTTGTAGAGATCACTGCATTTAGTGACCGACATGCAGAGTTCGAAAAGTTGAACACGGAAGTACTGGGTGTTTCTGTTGATA
GTGTG
GTGAGTTCTTTCTCCAAACTACGNTGAAACTTTAAATAGCCAGTATGCACATGAAGATACATGGTAAAGTTNCAGTATTCTCTAATTGCTTAGAGCTGGTAGAAGTTTTCACTTG
TAGCATGATTAAGTGAGGTCATATGCAATCTCTTGAGCCGGTGAAAATTCCCTTGTTACCAGAAAGAGGGAAAATAAAATGAACCATTATGATATGTTGTGATTTCCNTCTTCAACCCTG
AGACTGGGATGTCTGTGNNATTATAAAACANCGTCGCTCTGCAAAAGTGATGCCAATCAGCAAAATTTCATGTNGTATTCATGTTTTGAAACATCTAGATGCTTCATCATTATTTTTAGA
ATTTCCAGTGGATACCANTCATACCCTCTTGGGTGTTGTGCTAATGGCCAAAACTTCTTGCTATGTATGGTAGCTTCTGAAGTGATTAAAATTCNGGTGATGGTAGGGCCAAGGTACTGT
TTTGTGCTAATGATTATATCTCGTCCTCCTTGCAGTTTTCCCACCTTGCATGGATTCAAACAGATAGAAAGTCAGGTGGTCTTGGTGATCTTAAGTATCCACTTATATCTGATGTCACCA
AATCCATTTCAAAGTNATATGATGTACTTATCCCCGATCAG
GTATGATGACATTAATTCAGATACTTAAGTGGCATTTGTTTTCATGCTTTGCTCTGCATCATTGATTGGTNTCAATTCT
GGACTAAAGGGATGTTTCTTTCTGCGGTGTGTACTCTAGTCTCGCCATCTCTGTATTTAGACAAGAAATATCCTTCCATCAAGTGCTTGATTCATGCAAAACTTCCAAACATAAAACCTG
TCTTTTTTCCCTACAATCTGCTGTCATTTTCTTGATGTTGCTCATAATAGATGATAATCTGATCTGAATAGAATCTATTTCTTTGTTCTACTAGTCAAATTATATATATATATATAACAA
GTTCTTCTCACTGCATCAGGGAATTGCATTGAGAGGACTCTTTATCATTGACAAGGAAGGAGTTATTCAGCATTCCACCATCAATAATCTTGCCATNGGCCGCAGTGTCGACGAAACATT
GAGGACATTGCAG
GTAACTTAATTACGGTGGCTCTGCATGCTGCCAAGATACTGTAATATGCTAGCTTAGGTCACTCTTACATAAAAGACTCAAAATATATCATCTTCNCCATTGGGAAT
TTTCGTGTCTGCAGGCCTTGCAGTACGTGCAGGAAAACCCCGATGAGGTTTGCCCAGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAGCCAGACCCTAAGCTCAGCAAGGAGTACTTTG
CGGCCATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGCTCAGCTGCTTCGACCACCCTCATCTCCTCCAACCCCGCCTCCTCCTCCTCCTCCTCCTCCTTGGCCAAGAAGTCCCTGTCCCCCGTGATGCTCTCCTCCCCCCGGAGCGTC
GCTGTCCCCAAGTCCATCTCCGCTCTCGCCAACCCCTTCCTCTCTTCTCGCATCCCCAGATCGGTCGCTCCCTCCCGCGCCTCCAATTCCAGGCGCAGCAGCTTCTCCGTCAAGGCCTCC
AGTGAGCTTCCCCTTGTTGGAAATGTAGCACCAAATTTCGAGGCAGAGGCTGTCTTTGATCAGGAGTTCATCAATGTTAAGCTGTCAGATTACATTGGGAAGAAATATGTGATTCTCTTC
TTCTACCCATTAGACTTCACTTTTGTCTGCCCAACAG
AGATCACTGCATTTAGTGACCGACATGCAGAGTTCGAAAAGTTGAACACGGAAGTACTGGGTGTTTCTGTTGATAGTGTGTTT
TCCCACCTTGCATGGATTCAAACAGATAGAAAGTCAGGTGGTCTTGGTGATCTTAAGTATCCACTTATATCTGATGTCACCAAATCCATTTCAAAGTNATATGATGTACTTATCCCCGAT
CAG
GGAATTGCATTGAGAGGACTCTTTATCATTGACAAGGAAGGAGTTATTCAGCATTCCACCATCAATAATCTTGCCATNGGCCGCAGTGTCGACGAAACATTGAGGACATTGCAGGCC
TTGCAGTACGTGCAGGAAAACCCCGATGAGGTTTGCCCAGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAGCCAGACCCTAAGCTCAGCAAGGAGTACTTTGCGGCCATATAG

Retrieve as FASTA