Entry information : EguAPx-R
Entry ID 11378
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-02-11 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-06 (Christophe Dunand)
Peroxidase information: EguAPx-R
Name EguAPx-R
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx-R
start..stop
S start..stop
EglAPx-R 692 0 1..342 1..342
EgrAPx-R 692 0 1..342 1..342
EcamAPx-R 665 0 1..342 1..341
CsAPx-R 453 2e-161 16..342 10..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24064..24295 232 N° 2 24377..24458 82 N° 3 25069..25196 128 N° 4 25727..25797 71
N° 5 25980..26022 43 N° 6 26099..26195 97 N° 7 26366..26449 84 N° 8 27008..27129 122
N° 9 27490..27556 67 N° 10 28004..28106 103  
join(24064..24295,24377..24458,25069..25196,25727..25797,25980..26022,26099..261 95,26366..26449,27008..27129,27490..27556,28004..28106)


exon

Literature and cross-references EguAPx-R
Protein sequence: EguAPx-R
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342
PWM (Da):   %s   36327.28  
PI (pH):   %s   7.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSPSTTHLSPLTCCCSSSSLSSHHSSRRTKFEFPANSQRSSPSPIASRAGAIASPSSSTPGAASSGDHAPVRGRSVAGLAATLPFLLQLRGYTEGIVADAAELDNDEYTMIKEEVRKVVSKVKAAGVLRLVFHDAGTFEMGENGGMNGSIVYELERPENAGLKKPVKILEKAKGEVDAKRVSWADMIAVAGAEAVSVCGGPTIPVVLGRLDSMKPDPEGRLPEETLDALGLXQCFQRKGLSTQELVALSGAHTLGSKGFGNPVVFDNSYYKVLLEKPWMSAGMPSMIGLPSDRALVEDNECLRWIEKYANDQNLFFKDFENAYVKLVNSGARWRSL

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_3_8466 (24064..28106).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCACTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCC
CAACGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGCCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
GTTTCGCG
AATCCGGTCGATCGCGATCTTTCGGAGCTCNCAGCTGGAGACCGCGTCTCGAGGAGGAGGAGGAAGCTCATAGCCGTGGCGGGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGC
GGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
GTAAGCTCGACGCTCTTTGCTTGACGAAAGTCCATGTCTTTATTGGTTGGAACGAATGAAACGGGAATTTCGAGGGAGATTGAGA
TGCTTTTGAGCTTTGGAGTTGAGCCTGCGGAGCGAAAGAAGGCTATGCGTTTTCGTCGGTGGTCGGATTATGGGTTTTGCAGCTGCTTCTTCCGGTGATCAGTTTGTGTGTATGTGTGCA
TGCTACGGAGTTGTCCCGCCGAAATGACGCTTTTTGCTTCCTTTGAAGGACTTACTTGCCGTTTAAAGTAGGAGNTCCAGGTGTGGTCCTTCGGATTATGAGATTTTAGTTTGTGTTTCC
GGNTNGCTCATTCACTGACTTCCTGGATTTTAGTATCTGTAAGCTGTAACTGTGAATTGTCTTGTTTCTCAACATTGATGTTATGGACACCGCATTCAGCTGGGGAAAAACCATTTTGGG
TGATGGTTTGATGGGTCGAAATTGCGATTCGGAAGTACTANTTGGATAGGGCTGTGAGTTTGATATTTTGTTTATCGTGACCTTGGGGCTGCATCTGTATTTGTGTTGACTTGGGGCATT
TGGATATGTCCATGANTGTTGGTTTTTCATGTTCGTATATCAAAGATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAGGTAGTTTCCAAGGTGAAGGCTGCTGGTGT
GCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTATTTTACATGGACAGCAAGTTAAAGTTCTACAAATAATGATACTCGACATCAGTAACTGTGCTCC
ATATCTCTGGCTACAANTTTTGAATGCCTACTAATCGATCCAAATTGTTTTATCCTCTTTTCCCCATAATTGAACTTTTGAGCTGAAGCTAAGATGATGCATATATTGATTTTATCTGAA
TTAGGGGGATATAGCTCTCATTTNCCAAAAAAGTTAGATAATCCCTGTAAATGGGCATAACTTTTTTTTGTCATGGTGGTTTACTAAATGAACAAGGGCAAGTAATTCTATGACTGTTAA
AGCAACNACAGACTCTAATGGACCTTTATAAATGAATGATCAATCATAGAGAGCAGTATCATTCATACTACCTGTATTTGTGAACTAATGGTCATGTCCGATTCTTTTAATGCATGCACA
TACTTCTTTTGAGTTGAAAATTTTCTGCGTCATGCTTTTTTGTCTGAGTATGGATTTCAATCCTCATATTGTAATTCTAATATGTTTTTGTGTCAATATCCAGGTGGTATGAATGGTTCC
ATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAG
GTATGTTTTCTTTTATTACATCCTCAAGCTTAGCATCCATTCTGGAGATGCAACATTTCATTTCAA
CTGGTGTACNCCCTCATGCATTTCTGGACTGCTAGAAGTTCCTGTNTCTTATGTCTAGAACAGTCAACTCCGGTTCATCTTCAGGCTAACTCGTCAGTCATTGTNTTGNTGTTTAGATAC
TAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAG
GTGATTTTTTTGAGTGTTATATTCTATATGCTGATGGTATGATTGTGGTGATATAGATGGAACTTTCCTCTCTCAGTATCC
TGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCTGTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GTAAGAAGNTATTTCCAATTCANTTACT
ACTGTTCTGAAGATGCGTTGATGGCAGANAAAACATTATTTCACTCATTTAGTATTGTCANTATTGCAAGATTCTTTGCATGTCTCCATCTTTGTGCATAGTCCCAAGCTAATATTGGTN
TGGTTTCATTTCTTTATTGAAGGAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAANGCAGTGTTTTCAGAGGAAGGGCTTATCGTGAGTTGCTATCC
CATGTACATGTTGAATGATGCTTGCAAATTAAATGAAGTATTGTTTATTGACTATTGCATATTGTTATGCATCTTACTGCTGATGGTTAAACTGTTTAATAGATATTTCACCGGTCAACA
TAGAATTGGTTGTTTAGTCAACTGTGATACATTATGTTTTGCAATTACAGGATGATAGATTCAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACACACACACAA
AACAACCCCAAAAAAGCAAGACAACTATGCTTCCTTCTGTGGCAATAAGCATTCCTTCTTTGTTTTTCCCCTCCATTCCAAAAAAATTATGCCCCCTCTATGAGTTATTATTCTGACAGT
ATTAGCTGCATGATTACAAAAATGAAGCTTTCAAAACAGACTAAGAACATGTTTGATTGTTCCTGCTATGGACTCTGTTTGATTTTTTTTTGCTATAGANATCTGTCCTTTCAGTTTCTT
ANACTATTCTGTAGTTTCTTCTCTCAGCAAAAGGAACATANTGATGTTGTCCTCATCCTCTCAGGACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTG
GGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAACCCTGGATGTCTTCAG
GTAGCGAAAAAACATTGATGGTTCTCATGTTCTTCTGTTAGACTTTTTGCCGGA
CGTAGTTACGTTGGCCTGCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGTTGGCCTGCCATCAGCTTTCTAACCCAGGAAAAGATTCTATATCTGATACTATGGAGT
CATAATTGTGGTATTGTTTCAATAGTTAGCTCTGNTCCAGTGGAAATTTATTTAGTCTGTACTGGGAAAAGGTTATTCTCACTTTTTCTGTTGCAAAACCAACCTGAGTTTTTCTCATCG
GTAATAGTTCACACTTAAGCTTTGCTCTTAATTATCCCTTGCTTAATTTCCTTTTTCTCAATGCAGCTGGTATGCCGAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACA
ATGAATGCTTAAG
GTTACTGATTTGATATCCCTACTATTTCCTTTTTACTAGGAAGATGGGAACAGTTTAGCCATATCTTTCTGGCCATAGACTATTATGGTGAGATATATATATATCGC
TGTCACTGGCACTTGTCAACTTTCAGGGATGCACCATTATTGCCACTTTTGATTTTCTTTTTCTCATGATTCTGGATAAAAGTTGGCTTTTGTCTTAATGATCCAGTTAAATCCACATTC
CATAAATATGGGAGGTGCTATATTATCATGGCCTGTTTATGCTTCTGAGAAAGCAATGTAGAATGGAAATGTGCCGACACAACAAACATAAGTAGCCAGTCTGAAGTAATTAGTATCACC
TGATTTACTATGGATATTTTGCATGAGAATGTTCTGTTTAATGTGATATTTATTCCTTTCATTTGCTCGATCATGATACTTATATATTTTATATATACAGATGGATTGAGAAATATGCAA
ATGATCAGAACTTGTTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCACTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCC
CAACGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGCCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
CCGTGGCG
GGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCGGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
ATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAG
GTAGTTTCCAAGGTGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGG
CCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAG
ATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTT
TCTGTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAANGCAGTGTTTT
CAGAGGAAGGGCTTATC
GACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTGGGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAG
AAACCCTGGATGTCTTCAG
CTGGTATGCCGAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACAATGAATGCTTAAGATGGATTGAGAAATATGCAAATGATCAGAACTTG
TTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTGTGA

Retrieve as FASTA