Entry information : OsPrx128
Entry ID 1138
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx128
Name OsPrx128
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx128
start..stop
S start..stop
ZmPrx05 530 0 10..338 1..319
SiPrx164 527 0 11..338 6..323
SbPrx12 518 0 10..338 6..325
BdiPrx108 497 5e-179 11..337 4..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20381117..20381350 234 N° 2 20381451..20381639 189 N° 3 20382317..20382910 594  
join(20381117..20381350,20381451..20381639,20382317..20382910)


exon

Literature and cross-references OsPrx128
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8W2X2
DNA ref. GenBank:   NC_008403.1 (20381117..20382907)
Protein sequence: OsPrx128
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (307)
PWM (Da):   %s   34434.96 (31283.4)  
PI (pH):   %s   7.31 (7.31) Peptide Signal:   %s   cut: 32 range:32-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMRGGGATMLSWYLQVAAVSLLAMATGLEAQLRVGFYDNSCPAAEIIVQQEVSKAVSANPGLAAGLVRLHFHDCFVRGCDASVLIDSTKGNQAEKDAGPNTSLRGFEVVDRIKARVEQACFGVVSCADILAFAARDSVALTGGNAYQVPAGRRDGSVSRSSDTGGNLPPPTASVSQLTQMFAAKGLSQREMVALSGAHTIGASHCSSFSSRLYRAGTTAGGAGGGQDPTMDPAYVAQLAQQCPQSGGAAGGGALVPMDAVTPNAFDEGFFKGVMNNRGLLSSDQALLGDKNTAVQVVAYANDASTFQSDFAAAMVKMGAVGVLTGSSGKVRANCRVA*

Retrieve as FASTA  
Remarks chromosome 10. 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGAGAGGCGGTGGTGCGACGATGCTGTCGTGGTACTTGCAGGTGGCGGCGGTGAGCTTGCTGGCGATGGCGACGGGGCTGGAGGCGCAGCTGCGGGTGGGGTTCTACGACAAC
TCGTGCCCGGCGGCGGAGATCATCGTGCAGCAGGAGGTGAGCAAGGCGGTGTCGGCCAACCCGGGCCTCGCCGCCGGCCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GTCAGT
AGTGCCAATCCACCATTCTTGCTCGATATATCGATCAGCTGCATGCGAGAGTGGCTGGATGTGATGTGGTTGTGGATGATTTTTGGATGTGCAGGGGTGCGATGCGTCGGTGCTGATCGA
CTCGACGAAGGGGAACCAGGCGGAGAAGGACGCCGGGCCGAACACCAGCCTGCGTGGGTTCGAGGTGGTCGACCGCATCAAGGCCCGCGTCGAGCAGGCTTGCTTCGGCGTCGTCTCCTG
TGCCGACATCCTCGCCTTCGCCGCCCGCGACAGCGTCGCCCTG
GTACGTAATTAGAGAAATTTTACAGTACATAAGAGATATTTAAATTTTTAATGCAAATTCTCTTAACTCTTAGTACC
GAAGGTATCAATTTTTTTAATAGAAAATACGATATCTATTGGTATTTTCTCAAGCACTATAAAATCTCTTAGATGTAACTACACACTCTCACACACTATCGCACTTGTCAATTACTCGTA
CCCATTGCCGTTGCTTCAGTCTTACATCTGCCAGCTTTTGCAACTAGACATGATCATATATTCATATGGGTTTTGCAACGTAAAGCTTAATCTAGATATAGCGCACGTACGATTTGGGAG
GGAAAAAAAAAGCTAATCTTGAGTGATTCTGATCTATATATGCATGTCATGTCCCCAACTTTTCTGCACACGTTGGCACGTTGCCTTCACCACATGATGCTGGCATGCTGCACGGGGCGG
AGCTAGTATAGCTAGGGGGTGCCCAGGAACTCGGTTTAAAATTTTTTTTACTTATAGTTTATCTATTTTCACCATATATATACCCCGTCAGTTTAAACTTAGGTATCAGTATTAAGCTAA
ATTTGATTCAAACCAGAGTAAAGCAAGCGAGTGGAACCCCCTCATTTTGTTCTAGCTGCACCTGCATTATTACAGAAAAAAAGGGAGATTGATGCTGAAGTTTGTTTGTGTGGCGCGCAG

ACCGGCGGGAACGCGTACCAGGTGCCGGCGGGGCGGCGGGACGGGAGCGTGTCGCGGTCGTCGGACACCGGCGGCAACCTGCCGCCGCCGACGGCGAGCGTGAGCCAGCTGACGCAGATG
TTCGCGGCGAAGGGGCTGAGCCAGCGGGAGATGGTGGCGCTGTCCGGGGCGCACACCATCGGCGCGTCGCACTGCAGCTCGTTCAGCAGCCGCCTGTACCGGGCGGGCACGACGGCCGGC
GGCGCCGGCGGCGGGCAGGACCCGACCATGGACCCGGCGTACGTGGCGCAGCTGGCACAGCAGTGCCCGCAGAGCGGCGGCGCCGCCGGCGGCGGCGCGCTCGTGCCCATGGACGCCGTC
ACCCCCAACGCCTTCGACGAGGGCTTCTTCAAGGGCGTCATGAACAACCGCGGCCTGCTCTCCTCCGACCAGGCGCTGCTCGGCGACAAGAACACCGCCGTCCAGGTGGTCGCCTACGCC
AACGACGCCTCCACCTTCCAGAGCGACTTCGCCGCCGCCATGGTCAAGATGGGCGCCGTCGGCGTGCTCACCGGCAGCAGCGGCAAGGTCAGGGCAAACTGCAGGGTCGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGAGAGGCGGTGGTGCGACGATGCTGTCGTGGTACTTGCAGGTGGCGGCGGTGAGCTTGCTGGCGATGGCGACGGGGCTGGAGGCGCAGCTGCGGGTGGGGTTCTACGACAAC
TCGTGCCCGGCGGCGGAGATCATCGTGCAGCAGGAGGTGAGCAAGGCGGTGTCGGCCAACCCGGGCCTCGCCGCCGGCCTCGTCCGCCTCCACTTCCACGACTGCTTCGTCAGG
GGGTGC
GATGCGTCGGTGCTGATCGACTCGACGAAGGGGAACCAGGCGGAGAAGGACGCCGGGCCGAACACCAGCCTGCGTGGGTTCGAGGTGGTCGACCGCATCAAGGCCCGCGTCGAGCAGGCT
TGCTTCGGCGTCGTCTCCTGTGCCGACATCCTCGCCTTCGCCGCCCGCGACAGCGTCGCCCTG
ACCGGCGGGAACGCGTACCAGGTGCCGGCGGGGCGGCGGGACGGGAGCGTGTCGCGG
TCGTCGGACACCGGCGGCAACCTGCCGCCGCCGACGGCGAGCGTGAGCCAGCTGACGCAGATGTTCGCGGCGAAGGGGCTGAGCCAGCGGGAGATGGTGGCGCTGTCCGGGGCGCACACC
ATCGGCGCGTCGCACTGCAGCTCGTTCAGCAGCCGCCTGTACCGGGCGGGCACGACGGCCGGCGGCGCCGGCGGCGGGCAGGACCCGACCATGGACCCGGCGTACGTGGCGCAGCTGGCA
CAGCAGTGCCCGCAGAGCGGCGGCGCCGCCGGCGGCGGCGCGCTCGTGCCCATGGACGCCGTCACCCCCAACGCCTTCGACGAGGGCTTCTTCAAGGGCGTCATGAACAACCGCGGCCTG
CTCTCCTCCGACCAGGCGCTGCTCGGCGACAAGAACACCGCCGTCCAGGTGGTCGCCTACGCCAACGACGCCTCCACCTTCCAGAGCGACTTCGCCGCCGCCATGGTCAAGATGGGCGCC
GTCGGCGTGCTCACCGGCAGCAGCGGCAAGGTCAGGGCAAACTGCAGGGTCGCCTGA

Retrieve as FASTA