Entry information : EguAPx01
Entry ID 11380
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-20 (Christophe Dunand)
Peroxidase information: EguAPx01
Name EguAPx01
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx01
start..stop
S start..stop
EglAPx01 498 0 1..245 1..245
EgrAPx01 494 2e-180 1..245 1..245
EcamAPx01 493 2e-180 1..245 1..245
QshAPx01 465 4e-169 1..245 1..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5604..5722 119 N° 2 5161..5335 175 N° 3 5002..5067 66 N° 4 3696..3744 49
N° 5 3537..3619 83 N° 6 3321..3400 80 N° 7 3032..3134 103 N° 8 2849..2908 60
complement(join(2849..2908,3032..3134,3321..3400,3537..3619,3696..3744,5002..506 7,5161..5335,5604..5722))


exon

Literature and cross-references EguAPx01
Protein sequence: EguAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   26870.79  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YPTVSEEYRKAAAKCKRKLRGLIAEKHCAPIVLRLA*VISGTFDVQTKTGGPFGTIRHSAELAHEANNGLDIAIRLLEPIKEQFPILSYADFYQV*LVAVEITGGPEIPFHPGRPVS*FPPPEGRLPEATKG*FALRQVFGHMGLSDKDIVALSGGHTXVSRKERSGFEGPWTTNPLIFDNSYFK*E*SGDKEGLIKLPSDKALIEDPXFRPLVEKYAAVCSFFADYEEAHLKLSELGXXXX

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_1_1199 (5722..2849)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCCGACCGTGAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGTGGGCTCATCGCCGAGAAGCACTGCGCTCCCATCGTCCTTCGACTGGCGTAAGTAATCTCG
CGATCTCCGCTAGTTGCTTGCTTCGGCACCTGTTGATGATCCGGTCTAGAAGTTTCGAGTTCGTAGACGAATGCTTGAACTCACAGATGGNCCGATTTCGACCGTTTGACGATCGAACCA
TGTGCATTTTGTCCGGCTTAAGCATCGCTCCGTGGATAGAGAGTTTTGTTTCCGCATGTCGTGGATGCAGCTGGCGACTGTAGATTTGTCGGCGATTGTTTGATTTTTCTGGTTCGGTGT
TCGTTGGCGTCGCAGATGGCACTCCGCCGGTACCTTCGACGTGCAGACGAAGACGGGAGGTCCCTTTGGGACGATCAGGCACTCTGCGGAGCTCGCTCACGAAGCGAACAACGGATTGGA
TATCGCCATCCGGCTTCTGGAGCCGATCAAGGAACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAGGTATGACTGCCG
AATGCAATTACAACCAAAATTGAATTTAAGTAATCAAA
CTACGAAGCACGACGCTGAAATCTTGATATGTTGTATTGGAAGTTGGCTGGGGTTGTTGCTGTTGAAATAACTGGAGGGCCCGAGATTCCTTTCCACCCTGGTAGACCGGTAAGTTGATT
T
TCATCTTTCTTCCAAAACTTGTTTTCTCTATTTGGCCGCTAAAGTAAGGATGAGCTAACTATTCATGCTCAATTTAGAAGCTTTCTTAAGTGGTTTGATGAGGTGTTTAGCTGCATGAC
CNTGCTGTTGTTCTTTTCTCAAANTAGAATTAAGAGATATGTGCNTGCTGGGATTCTGTTGCTGTTCAGCCTGAATAAACTATTCTAGCTCTTCCCATAGAAACTTTGTAATCTTTGAAT
GAATGGCAGCTAGTGTCGGTAGGATTTTGTGAGAATCTAAATAGTAGGAAAGGGGGACACTAAGAACTTCATTGACAAACATAGAAGGAGATTCGCTTAGGTACGTAAGAGAGTTGATAG
TATCCCAGGAAGCAAACAGATACGAGTTAAAAATCTTCTAGTACTGGAAGTTCGATAACTTGTGAATGGTAATCATCCTGAGAAACCAACTCCTGTGAAATGTTTATGAGCGAGCTAGTT
TTNNNNNNATAANNNNNTCNGGAAATNNNNNNNNNNNNNNNNNNCATCGACCTAATTATAATCGGAAATTCAGTGAATAGCTTCTAGAANTATAAGCATGATGTCCCTGTCTTCTTGTCT
ATTGAACTAATGCTGANATTGAATATCGGAGTCCTCCGGAGTTATTAAAGACGATGTCAAAATGAAAATTGTGTGGGGATCTCCAGATAATTGGATAAAATTGTTTTGATATGTGCGGTT
TCACTCTCAGAATTGATGATGATTGATGTGTTTCTCGGTTGATGATTGATGTGTATCGTGCCTCCTATTTAGCCTATGAATGTCCCTTCTGGTATGCTCACTCCGTTCTCTCTTCTTGAC
GAAAAGTGGGGTTGGAGATTTCTTGGTTGCTATAGACAAACAGAATAAGAAATGATTCCTCTCGTTGAAACTCTGGCAACTATACTTAGTTTGTCTGACAACCCGACTTGAGTGATGCAG
GTTATGCTTAGTATGTTACTTTGAAATTTCAAATCCTTTAGCTTAATATCGGCCTTCTCATTATACTTTCTTACAACGCAATGGTCAATCCTGTTTGAAATATTGNTTGTTNAGATAATA
TACTGTTTTCTTGGTGTATTAGTTAGTAGGCTATNTNATACTNGGCATCATAATTCATAGAAACTTGAATCGCTTATTCCCACGGTTCAGATAAAAGCAAAAGTTCTCTAACATATATTA
GATATGAAGGTATCAATAAATCTCTGATAAANTACATTTTGCTCAGGACAAAAATGAACCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAGGTTAGTTTGCTTGCAGTAAAGTGCG
AGAAGATTATTACTGGTGTCTATGCTTTGACAAGTAAACCACTCATTTCAGGTTCCGACCATCTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCGTTGCCCTATCNG
GTGGGCACACTNTGGTAAGTCGATTA
GTCACACAGAGTTAAGTTTCACTCAGAATTACATATTTGCTAAGAATTAAGTCCATGTTGCTGTACAGTTTTNGAGACCTCNTGAATTCTCTAT
ATTAATGCTCCCTTGCGCTCCTTTCTACAGGGCAGATGCCACAAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTTAAGTAAGAATGA
TC
TTGCTCTATTCTTCTATAGTCAACTCAGCAGTTATATATCACNTGCTTAAACTTTGTAANCAGCTTCTTGACTTGCTTAATTAGCGCAGAGAAAAAAANATGGTTTTGACTTGCTTAT
GCTGTTGGTCCCTAATGCTGACAATTTTGATATCTGTGGATGTTCCTATGAAACAGGGAACTCCTCAGCGGAGACAAGGAAGGTCTGATCAAGCTACCATCTGACAAGGCTCTTATTGAG
GATCCCNTCTTTCGTCCTCTTGTTGAGAAGTACGCTGCGGTATGTTCGCAA
CCCAATGTCCTATCGTCATTTCAGAGAATTTTGCGGGGCCATCGATGGTGGAAACAATTTNTTTTTTTT
TTGGGTGATCGTCTAATCGGGAGGCNGCTTTGGATGTTTCAGGACGAGGATGCATTCTTCGCGGATTATGAAGAAGCTCATCTGAAGCTGTCAGAGCTAGGGNNNNNNNNNNNN

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCCGACCGTGAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGTGGGCTCATCGCCGAGAAGCACTGCGCTCCCATCGTCCTTCGACTGGCGTAAGTAATCTCC
GGTACCTTCGACGTGCAGACGAAGACGGGAGGTCCCTTTGGGACGATCAGGCACTCTGCGGAGCTCGCTCACGAAGCGAACAACGGATTGGATATCGCCATCCGGCTTCTGGAGCCGATC
AAGGAACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAGGTATGACTGCCG
GTTGCTGTTGAAATAACTGGAGGGCCCGAGATTCCTTTCCACCCTGGTAGACCGGTAAGTTGATTT
CCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAGGTTAGTTTGCTTTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCGTTGCCCTATCNGGTGGGCACACTNTG
GTAAGTCGATTA
AAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTTAAGTAAGAATGATCCGGAGACAAGGAAGGTCTGATCAAGCTA
CCATCTGACAAGGCTCTTATTGAGGATCCCNTCTTTCGTCCTCTTGTTGAGAAGTACGCTGCGGTATGTTCGCAA
TTCTTCGCGGATTATGAAGAAGCTCATCTGAAGCTGTCAGAGCTA
GGGNNNNNNNNNNNN

Retrieve as FASTA