Entry information : EguAPx07
Entry ID 11383
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguAPx07
Name EguAPx07
Class Ascorbate peroxidase    [Orthogroup: APx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx07
start..stop
S start..stop
EglAPx07 712 0 1..356 1..356
EgrAPx07 710 0 1..356 1..356
EcamAPx07 572 0 63..356 20..313
VvAPx07 556 0 2..356 1..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47927..48049 123 N° 2 47680..47778 99 N° 3 47391..47475 85 N° 4 47262..47296 35
N° 5 47068..47133 66 N° 6 46922..46962 41 N° 7 46349..46479 131 N° 8 46059..46165 107
N° 9 45374..45511 138 N° 10 44722..44856 135 N° 11 44379..44486 108  
complement(join(44379..44486,44722..44856,45374..45511,46059..46165,46349..46479 ,46922..46962,47068..47133,47262..47296,47391..47475,47680..47778,47927..48049))


exon

Literature and cross-references EguAPx07
Protein sequence: EguAPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356
PWM (Da):   %s   38056.36  
PI (pH):   %s   5.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMGASFVSTVPSLLPLQAQVAPPSSSTSSSAASVRPPAARPVAVRCKTENGFADGGEELSRRDVLKLVGASVGIELMASSGSFVESARAADLIQRRQRSEFLSNVRGTFFTAIGNPDLIPSLLTLAXNDAMTYDKASKSGGPNGSIRFSSEISRPENKGLSAAMNLLEEAKKEIDSYSKGGPISYADLIQYAQSALKATFLASAIRKCGGNEEKGGLLYTAYGSSGQWGLFDKQFGRSDTTEPDPEGRVPQWEKASVKEMKDKFSAIGFGPRLAVMSLFLGPDQTATETLLAADPDVSPWVQKYQRSRETVSETDYEVDLITTLTKLSSLGQQINYEAYTYPVPRVDLSKLKL

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_6_19744 (48049..44379).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGCGCGTCCTTCGTCTCCACCGTCCCTTCTCTGCTCCCGCTTCAAGCTCAAGTCGCTCCTCCTTCTTCTTCCACCTCGTCTTCCGCCGCCTCCGTCAGGCCCCCCGCCGCTCGT
CCC
GTTAGTCTTCCTCCTCGCTTCCGCTTTTTCTGTTTCGAAATCCGGCATTGTGAATTGCTCTCGTCGGTGTCCGCGCTCGACGCTGCGTAGTTGAGCCTCCTGATCGGTGTGTAATGC
TTGTCGTCTTCTCCGGTCGTCGAAAGTTCAGGTTGCGGTTCGCTGCAAGACGGAGAACGGCTTCGCCGATGGCGGCGAGGAGTTGAGCCGACGAGACGTTCTTAAACTCGTCGGCGCTAG
CGTCGGCATT
GTAAGTGCGATTCCTCCCGTTGTTTAGCCGTTACGTCAGCTNCATTGAGCTCCGNGAATGTGATCTTCCGTATGTTTTATCTGTCTGCTCGGTCGCGATTAAGATTTCGT
TCTGGTTCGCCGTTTGACCTTTGGCTTTGTGGAAATGACGGTCCGTTCTTTTAGTGTGGATGTTGATGAGTTTCTGCCAGCTGTGATCTCGCAGGAACTGATGGCGAGCTCTGGATCATT
CGTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCNGAGTTTCTTT
GTAAGCCCCCGTTGAAGAGTCGCTTCTTTTTCTATTGCTAGTGCATTGAAATATGAATCTC
CAGAATCAAATTGACTTCCTTCTGTGTCCTCAGCAAATGTCAGGGGCACCTTTTTCACGGCTATAAAGGTGAATTTTTGTTTTGCTTTGGCATTTAGGCATATGATTTTGGCTCTCATGA
TTTTGTTACACATATCCTAAAATGCTATACTTTGATATAAATTTATTAATTGATTTCTCTCTTGGACTCATTTCAGGGAAATCCAGATCTCATCCCATCTTTACTGACGTTGGCATTNAA
TGATGCTATGACTTATGACAAG
GTCACACTTACATTTTGCATGTTGAAATTTAATGGGAATAGTTCATCTCACTAAGTATGATTAGGTAATGATTGGGTGCTGATTTATTTTCCCTCAAG
CTTGCAGGCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGGTACTTGTCACATTAAAACATGTGAATGCTGATGTGAGTTGATGATCATAGCGCAGAGCAGTATTTTCAATT
TGTTGGGTTTNGTGAGCCCCCTNATTTCGATTTTCTGAGGGTTGAACTCTTCACACAACCGGCTCCCTCTCAGAATGATAATCTAGCGAGGTCTTTGTTTCACACAACCGGCTCCCTCTT
ATATGCAGTTCTATATTACTAATTCAATCTTATCCAGAAATCTCCATTTAGAGAATCAAGAAGCTGAGCATCTAGAGTTAATTGAGGAAAATAGAAAGAGAAAACTTGATTGCCCCGCAG
GATGGTTCCCATGTTTCAAGTTCTCATGTGTATCTTCCAGTTTAAAATTTCATGCTTTTGCCGCACATCTTTTATCTCCTAGATGAGACTCACCATGATTTCCAATGTCATGAACTGTTA
TTTCTTGAAGCTCAGAGATTAGCAGACCCGAGAATAAGGGCCTTTCAGCTGCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATATCCTATG
CAGATCTTATACAGTATGCAG
GTTTGTACATGTTAAATAGCTAAGTTGCATGTCCCTAGCATAAAATGCTGCTCTTGGTCTGGACTTCTGTTAGTACCTTCTAGAATAACCCCCAAAGGA
AGAAGTATTCACTAGAGCCATTANGCTTGGGGATCTGGCTTTGAATATCTTATGCCATGTATTGAAAGTTCTGCCTCTGAACAGCGCAGAGTGCACTCAAGGCTACCTTTCTAGCTTCAG
CCATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGGGCTTGCTCTACACTGCCTATGGTTCCAGCGGACAG
GTAATTCCTAATTCGTTGTGTGCATGGAATCTTATGCGTTTGCCACCAG
ATTTTATAGTGTATAATCAACAACGAAATAGGAATAAAATTTCCTACAACTAGTAATTTAGTATTCATAATGTGTTACCATCAGGACTTTTAGTCAGTGTATCTTGGGAGGTGAACTAGT
TTAGGTATAGGTATAGATAAGTCTAAAATTTACTTGCAGCCAGTAGTTTCTCGGGGAATATTCAAAAAATGGTTTCATGCTAAACAACAGNTGATGGATTTGTTTCAGAATGTATTGCTT
CATCTGACGATTGCCATAAAATACCGTGTTTATTGACCATTTGTTGTTGCTCACTATTGCTATGTTCATTCAATAGCTTGATTCTTGAATACATGTTCGGAAANAAAAATGATCCCTATA
GTTTACCAATTTTTCCTTTGAATATATTGGAAATAAACCTATGAATAACATAACAACTGCCTTGACATATTGTTTCTCAAATAATTCTCATAGTTTTAGTTCTGATTTTCATATTACATA
TATCGTCCCNTCATGCAGTGGGGCTTGTTTGACAAACAATTTGGGAGGTCAGACACCACGGAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAA
GATAAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
GTATATTCAGTAGAACATTTACTGCTTATGCAGGAATACTCTGAACTTCCATACATATTGTCCTCTTTATGCACCAAGAATTTC
ATCTACAAAATTGCAACGGGAAAACAAGGTTATCTTTTCACCATTTCCAGAAACCAAGAGACATGCGGCTGAACAAGCAGTTTCATGATGTGCACTGCATTCAGATATATTTGATGATTC
ATTTCTCTATTATGTTAATCTTCTCTGAATTAGCTAGATTCTTTTCTTAAATTTCCATACCATATATATTTTTTTTGGTAAGGTANTTCCATACCATATATTGTTTTCTGCATCTTTATA
TTTTTGGAAATTTTTTCAAAGCTCAAAATTGGAGAATTGAATGTGGTTTTCTGTGAAATGATCTCTATTTGCAGATTGGTCTTGTAATGAGATTTAAACATTCTCAGCGTTGCTTCCCGT
CAATCTCGAAAACTGGTAGTCAATGATGGACTGCATAGGAACTAAATCTGCTTTTAACTTCTTGACTGAACAGCTAGCAGTGATGTCTTTGTTTCTGGGTCCTGATCAGACAGCAACAGA
GACATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTTGGTTATACAAAGTTGCTCTTTTCAGAATG
TGAAAGCCTTACTTGATATTTGCCATCATGGTGGTGAAGAATAACCGAAGAAAAACAATATTATGGCCTTCTGTGCCCCAAGAAAAAACGGAATCTCTGAATCGTAATCGATTTGTTGGC
CAAAAAGAATAGTTAATGTAAGCGTCTTAGAATCGTTGCATTCGCTTCACTCGGACATTGATCTTAATCCCGTCTTTTTACAGGTCGATTTGATAACTACTCTGACCAAATTAAGCAGCT
TGGGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCNAGGGTTGATCTCAGCAAGCTCAAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGCGCGTCCTTCGTCTCCACCGTCCCTTCTCTGCTCCCGCTTCAAGCTCAAGTCGCTCCTCCTTCTTCTTCCACCTCGTCTTCCGCCGCCTCCGTCAGGCCCCCCGCCGCTCGT
CCC
GTTGCGGTTCGCTGCAAGACGGAGAACGGCTTCGCCGATGGCGGCGAGGAGTTGAGCCGACGAGACGTTCTTAAACTCGTCGGCGCTAGCGTCGGCATTGAACTGATGGCGAGCTCT
GGATCATTCGTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCNGAGTTTCTTT
CAAATGTCAGGGGCACCTTTTTCACGGCTATAAAGGGAAATCCAGATCTCATC
CCATCTTTACTGACGTTGGCATTNAATGATGCTATGACTTATGACAAG
GCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGCTCAGAGATTAGCAGACCCGAGAATAAGGGC
CTTTCAGCTGCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATATCCTATGCAGATCTTATACAGTATGCAG
CGCAGAGTGCACTCAAGGCT
ACCTTTCTAGCTTCAGCCATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGGGCTTGCTCTACACTGCCTATGGTTCCAGCGGACAG
TGGGGCTTGTTTGACAAACAATTTGGGAGGTCA
GACACCACGGAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAAGATAAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
CTAGCAGTGATGTCT
TTGTTTCTGGGTCCTGATCAGACAGCAACAGAGACATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTCGATTTGATAACTACTCTGACCAAATTAAGCAGCTTGGGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCNAGGGTTGATCTCAGCAAGCTCAAATTG

Retrieve as FASTA