Entry information : EguAPx08
Entry ID 11384
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguAPx08
Name EguAPx08
Class Ascorbate peroxidase    [Orthogroup: APx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx08
start..stop
S start..stop
EglAPx08 883 0 1..446 1..446
EgrAPx08 806 0 1..446 1..446
EcamAPx08 712 0 95..446 1..352
GmAPx07 659 0 17..446 10..432
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3178..3426 249 N° 2 3772..3915 144 N° 3 4394..4514 121 N° 4 4588..4688 101
N° 5 4799..4886 88 N° 6 5562..5629 68 N° 7 5716..5802 87 N° 8 7006..7080 75
N° 9 7168..7245 78 N° 10 7331..7435 105 N° 11 7943..8014 72 N° 12 8301..8453 153
join(3178..3426,3772..3915,4394..4514,4588..4688,4799..4886,5562..5629,5716..580 2,7006..7080,7168..7245,7331..7435,7943..8014,8301..8453)


exon

Literature and cross-references EguAPx08
Protein sequence: EguAPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   446
PWM (Da):   %s   47965.73 Transmb domain:   %s   o426-445i
PI (pH):   %s   8.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQLLPLQPQSFSSSPPPSASTATASMASLTGAAAASRLLPSASRARLRLSLSSSAGRSPASPLSSLRCLRGSSPLASRLFLSQRRPSMXLLAAQYSGAASPKCAASDPEQLKGAREEIKELLKTKFCHPLLVRLGWHDAGTCNKNIEEWPKRGGANGSLRFEIELKHAANAGLVNALKLIEPIKEKYPSVTYADLFQLASATAIEAGGPKIPMKYGRVDISKPEECPEEGRLPDAGPPSPADHLREVFYRMGXNDEIVALSGAHTLGRSRPERSGWGKPETKYTKDGPGAPGGQSWTVQWLKFDNSYFKDIKERKDEDLLVLPTDGVLFEDPSFKVYSEKYAEDQEAFFKDYAEAHAKLSNLGAKFDPPEGIVIDGPAKAAPEKFVAATYSSGKRELSDTMKQKIRAEYEGFGGSPDKPLQSNYFLNIIIVIAALALLSSLVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_6_22532 (3178..8453)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAACTCCTCCCCCTCCAACCGCAGTCCTTCTCCTCGTCACCGCCACCATCCGCGTCGACAGCAACGGCGTCCATGGCTTCTCTCACCGGCGCCGCCGCCGCCTCCCGCCTCCTCCCC
TCCGCCTCCCGCGCCCGNCTCCGCCTCTCCCTCTCCTCCTCCGCCGGCCGCTCCCCTGCTTCTCCCCTCTCCTCTCTCCGATGCCTCCGCGGATCGTCCCCGCTCGCTTCTCGCCTCTTC
CTCAGCCAG
GTACGCCCGCGCTTGCTTCCTTTCTTTCCTCCAATCTCGCGTCTCGCCTCTTCCTCGGCCAGCTCGAGCTTAGGATTGGGCGTTCCTCTCTCAGTGGAGCATTCGCGTGTG
GTGATCGTGCGTCGCTTTGCTTTGCTCTCGCTGTTTTGCTCCGATTAGCTGCGTTTCGGTTCGGTCTCTCTCTGAGTGCGTCTGTCCGGATGTAGCTCTGCTTAAGTCGTTTACGTTGGA
TAAGCGCGTGTGGATCGTGTACATTCCGGTCCTGTTCCCTTATTGCTGTTTCGATTCCGTCGTCTCGTACTGCTTCCCCAGTGGTTTTCGGCTTGACTCGTGATGAAAATGCAGAGGAGG
CCGTCCATGNACCTGTTGGCCGCGCAGTACAGCGGAGCCGCGTCTCCGAAATGTGCTGCGTCCGATCCGGAGCAGCTGAAGGGCGCCAGGGAAGAAATTAAGGAGCTTCTCAAGACTAAG
TTCTGTCATCCTCTTCTG
GTAACGTGCCTTCTTATCCTTTGCAAAAGGATTAGTTCTTATTCTGCCTGTTTACGTCACTCGCTTGAATTAGCCTGCTCTGATTTTCGGTGATTTTGGAAG
ATATATGCTTTGATCGCGTCACGAGATGATGCTGAATGAACGGAATTGCTCTTGCTATTGTAATGTGTTTAGCCTACTGCACAAATTCATCTATCCCCTGAAGAAAGCGTATCTATTTTT
GGAATGAACCCTTAGTTGAGAAAATACACCTCTGAGATGCTATGGATAATTGAAGCACCTGAGATTTTGAAACTTCACTACATTGTTCCCACCCGTTTAGCTAGCTGACAACAGAGAACT
GTAAATCCTGAAGTGGCTAATCACCATGTTCCCACCCATCTATGCAATTTACTAGGTCTGATAGTCTCTGTATTACATGTGTTTTGTAGGAAAAGGAAATAGAATTTGCCGTTAATGACA
TATGAGTACTTTACAGGTTCGGTTGGGATGGCATGATGCCGGTACTTGTAATAAGAACATCGAAGAATGGCCTAAAAGAGGTGGAGCTAACGGGAGTCTTCGGTTTGAAATTGAGCTTAA
GCATGCAGCTAATGCTG
GTAATAATTTAGCAGTGATACTACGGGTGGCATGACTTGTTTCTTGAACTTCTCTCAAAANTAGCTTTTACAGGTCTTGTAAATGCACTAAAACTTATTGAGC
CAATCAAAGAAAAATATCCCAGTGTGACATATGCAGACTTGTTTCAGCTGGCTAGCGCTACTGCTATTGAG
GTCAGTTTTTGCGCTCTTAATTGCTTAACCTGAGATTTCTTGAAGCCAT
ACGTAACCTGAGATTCACTCGTTCTTTGTGAAAATGTTCTTCCTTTTACTTTATTCTTCAGGAAGCTGGTGGTCCCAAGATTCCCATGAAGTATGGAAGAGTTGATATCTCAAAACCTGA
GGAGTGCCCTGAAGAAGGGAGGCTTCCTG
GTGAGTGAAACATTGTTGTTCATTAAAGAGTAGACATNCACTCGGCTTTGTTGTACTAGGGGATCACTAATTTGGCTCTATGAAGCACTGT
AACTATCTCGCGCAAGTTGTTGTGATCTGCCGATTATTCGACTGCTTTTTCTATGATAATTCTGAGTGGGCACCCTAACATGCAAAGGCTTTTTTTTTAGGTGAGATTTGTACTTAAGGT
TGAAGGTGGTAATGTTAAAGAACTGTAATTTGCTGATTTGGGCAACAGATGAAGTTCTAGATGACTTGATTCATTTAGGCATTTACNAAAAAAATTCAAGCAACAAGAGATGTATTCATC
CTAGGTCTGTGTTTTGTTTCTGAATGGATCACANTCGTATGCATGGTAAGCTCTTGAAACAAAGCATTGTTTGGAAAAAAAAAGAATATGCATTTAAATGCGCTTTGTTACACATAAATG
AACTTGAATATCCCGTCCTTTCTATGGTCAGAAGTCATTTTCTATCTCTNGTCTGGAGTTTTCACTTTTTTATTCTGTCTCCGGTGATTGATTTCTTCTGTTTCTCGGATCCTTTTGTCT
CACTTATTAGTGTACTTTCTACTTCTGCCAGAAAAAAAGTTTTTGTCGGTTCCTCTTGGAACAATCCATTTCTTCTCTTTTTACTGAACAGTTCTTTCTTTCAGATGCTGGCCCCCCTTC
ACCAGCCGATCATCTCCGGGAAGTTTTCTACAGGATGGGANTAAATGACAAG
GTTTTTGTAATCGTTACCTAATGGGATGTTGTGTGCTATTTGTGTGTATCTCATGTNCTTGAGACTAT
GAATTCTCTGTTCCGCAGGAAATAGTTGCTTTATCTGGGGCACACACTCTTGGAAGGTCAAGACCAGAACGTAGTGGGTGGGGCAAGCCAGAAACAAAGTACACGGTAACTAATTACTTT
CTATTTATTAATGTAATGCTCCGTACTTATCATTTGACAAACTCAACTTGCCATAGGAATTCTGAAACAGCATGCATAGTGTCGAGAATGTATTTTCCATGGTTANCATTGGTGAATTGA
AAGTTATCCTCGATATACAATTAGAGTTATGAACTCTTGATCATCTTTAAACGAATAACAGGGAACAGGACTCTGATGGTCATAGTTGTGTCCATTAAACGCGAAAAACTACAGAAATGT
TTTGTTTGGATTTAGAAACAATATTTCATTGAGCTCCAAGCACTTAAGGAGCTGTGCAGTAGGATGGCGTTCTATGAGTGATCAACCATCAGAAATAGATTGATATTCCCAAGGACGTTG
TTGTAAATTCTTTTATGTGCTTGTAATCTCCATTGTCTCACACAGTTGCGACTCATGGTTCGGGTTACAATATTTTGGCTTGATGGTCACGATGATGCCCAGAAAAAGTAGCCATTTACA
GTGTGGCTTGTGACCACGTTAATGAATCTCAATAGCCATATTTGTTGCCATGGGATTTGCGCCTCAGAGTCTCTTTTGTTAAGGATGACAGTTGACTATTAATTTCCATAGAGGCNGTCC
ATATCAACTGATATTTGCAGATCTTTTCTTCTAGGAGTACAACAAGCAAGCATTTTAGGGGTTAGTTGGTCAGCTTAAAGAGTTTGTTTACATCATTACCCTCTGTGTAGTATCAAATCC
TCTATAAAACTCAAGAACTCGGCATCTTTCTAAAAAGTATCCATCCACGTCTTTTAGGTCTTATTTACCTCTTTTACATGTGTCCATTGTAATGTCACATCTTCTTACTTTATCATCTGT
AGGCCATTGCCTTTTGTGTCCAAACTACTTTAGAAAGGTTTTTCATCTTATTCCCACTTTAAGCCACCCCCTCAGCTATAATCTGTTCTAACTTGATCTTGTGTTAGTGTCCAAATATCC
TTAGGCATTATTATCTTAGCTATATTAGTTTCGTACGTGTGCCTTTCTTACCGACAGTAGAAATGGTTGTGGACATTGAAGCTTGGGAAAAGTTTCTCCCCAGTGGACAAATTAATGGCT
GCTTGAATTGAACTTATATGACTATTTTCAACAATATAGTTTAGTTGAAATGATTAAGAATAGTATAAATGGCCTTCATGAATCATAATGGCCTCCATCATGTCACAGAAAGATGGACCA
GGAGCACCAGGTGGACAGTCGTGGACCGTGCAATGGTTGAAGTTTGATAACTCATACTTCAAG
GTTTGCGAGTTGAATCCATACGTGCTTTTTCCATGGGAAGGTGGTGATTCAGAATCA
AGTGGGATGCTAACTTCATGTTTCATGCAGGATATAAAAGAACGGAAGGATGAAGACCTGCTGGTATTGCCAACTGATGGTGTTCTTTTTGAAGATCCTTCATTCAAGGTAATAAGAGTT
TTTCTGAAAGCTCCAAAATAAAAGAAGTCTCTAAATTTGAGTTATCTTTCTAAAGAATGTTGGCGAATTGCAGGTCTATTCTGAGAAATACGCTGAAGATCAGGAAGCATTCTTTAAGGA
TTATGCTGAAGCACATGCAAAACTCAGCAACCTTGGTGCAAAATTTGATCCTCCAGAG
GTTTGTCAGTGCTCTCTTATGGTCATTANTTTGCTAATTGTAGTGACGCTGGACCGTGTTCA
AATCATTTCCAATGCCTTCTTAATTTTAAGTTTTTAAGGAGCCAATGGCCAAAGTTCTATAAGAACTGTCCGAATATTTGAAATTCTTCCATGATGTTCATGTTGGCTATTCAACCATCT
GTTGTGATGGCATTGGCCTCTGGATCAAGTGAAATTTGTAGGATTGATGGGGCCTCCNATTTGGAGACGCATCAATTGTAGTTTTATTGCACTTTATTGCACGGCATGAATAACCATCAA
GTTCATCTTATCAGCATTGATGTTTGGCTTGTTATGGAAAATTTGTGCGTAGATAACAAGCGCTTCTACTTATTTACAAGTTTTTCTTGGGTCTAGATTTACAAGTTTTTCTTCAGTCTA
GATTTACTAGTTTGCAATTTAACTTATACAGAACGTGGGTTAGAGTTGTGGTGAAAACTAAAGCTTACGTTGAGTAATCTTTCAGGGTATTGTGATAGATGGTCCTGCTAAAGCTGCACC
GGAGAAGTTTGTGGCTGCCACCTACTCATCTGGAAAG
GTTATACTAAGAAATAACTTACATCTTGATCTTCCATTGTTACAGAGAGTTCCTTTTCATTATGCGATCTTTAACGGAGAGAC
TATTTCTTTGCAAATTGTTCATGTTCCTTGTTTCTTATGGTTTGCTGCAGGATTAGAAAACAATGTCCCGTTTTCTGTGCCGTGTCTTTTATAAATAAAAGATGGAAGATATTTTCAATC
TTGTGAAACCACTTCTTAAAACTTGGGGAGTCTTAGCGAAAGGAGGAATAAAATTCAATGCGTGTTGCGTATTTGAATTGCAGAGAGAGCTGTCAGATACTATGAAGCAGAAGATCCGAG
CTGAGTATGAAGGATTCGGTGGCAGCCCAGATAAGCCCCTGCAATCCAACTATTTTCTGAACATAATCATTGTCATTGCTGCTTTGGCACTCTTGTCATCTCTAGTAGTAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAACTCCTCCCCCTCCAACCGCAGTCCTTCTCCTCGTCACCGCCACCATCCGCGTCGACAGCAACGGCGTCCATGGCTTCTCTCACCGGCGCCGCCGCCGCCTCCCGCCTCCTCCCC
TCCGCCTCCCGCGCCCGNCTCCGCCTCTCCCTCTCCTCCTCCGCCGGCCGCTCCCCTGCTTCTCCCCTCTCCTCTCTCCGATGCCTCCGCGGATCGTCCCCGCTCGCTTCTCGCCTCTTC
CTCAGCCAG
AGGAGGCCGTCCATGNACCTGTTGGCCGCGCAGTACAGCGGAGCCGCGTCTCCGAAATGTGCTGCGTCCGATCCGGAGCAGCTGAAGGGCGCCAGGGAAGAAATTAAGGAG
CTTCTCAAGACTAAGTTCTGTCATCCTCTTCTG
GTTCGGTTGGGATGGCATGATGCCGGTACTTGTAATAAGAACATCGAAGAATGGCCTAAAAGAGGTGGAGCTAACGGGAGTCTTCGG
TTTGAAATTGAGCTTAAGCATGCAGCTAATGCTG
GTCTTGTAAATGCACTAAAACTTATTGAGCCAATCAAAGAAAAATATCCCAGTGTGACATATGCAGACTTGTTTCAGCTGGCTAGC
GCTACTGCTATTGAG
GAAGCTGGTGGTCCCAAGATTCCCATGAAGTATGGAAGAGTTGATATCTCAAAACCTGAGGAGTGCCCTGAAGAAGGGAGGCTTCCTGATGCTGGCCCCCCTTCA
CCAGCCGATCATCTCCGGGAAGTTTTCTACAGGATGGGANTAAATGACAAG
GAAATAGTTGCTTTATCTGGGGCACACACTCTTGGAAGGTCAAGACCAGAACGTAGTGGGTGGGGCAAG
CCAGAAACAAAGTACACG
AAAGATGGACCAGGAGCACCAGGTGGACAGTCGTGGACCGTGCAATGGTTGAAGTTTGATAACTCATACTTCAAGGATATAAAAGAACGGAAGGATGAAGAC
CTGCTGGTATTGCCAACTGATGGTGTTCTTTTTGAAGATCCTTCATTCAAG
GTCTATTCTGAGAAATACGCTGAAGATCAGGAAGCATTCTTTAAGGATTATGCTGAAGCACATGCAAAA
CTCAGCAACCTTGGTGCAAAATTTGATCCTCCAGAG
GGTATTGTGATAGATGGTCCTGCTAAAGCTGCACCGGAGAAGTTTGTGGCTGCCACCTACTCATCTGGAAAGAGAGAGCTGTCA
GATACTATGAAGCAGAAGATCCGAGCTGAGTATGAAGGATTCGGTGGCAGCCCAGATAAGCCCCTGCAATCCAACTATTTTCTGAACATAATCATTGTCATTGCTGCTTTGGCACTCTTG
TCATCTCTAGTAGTAAATTGA

Retrieve as FASTA