Entry information : EguAPx11
Entry ID 11386
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguAPx11
Name EguAPx11
Class Ascorbate peroxidase    [Orthogroup: APx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx11
start..stop
S start..stop
EgrAPx11 530 0 1..267 1..267
EcamAPx11 485 8e-177 16..259 1..244
EglAPx11 480 2e-174 4..265 1..262
LeAPx06 409 4e-146 5..247 6..246
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12897..13006 110 N° 2 12565..12689 125 N° 3 12409..12458 50 N° 4 11813..11878 66
N° 5 11684..11732 49 N° 6 11446..11534 89 N° 7 11262..11341 80 N° 8 11074..11176 103
N° 9 10779..10910 132  
complement(join(10779..10910,11074..11176,11262..11341,11446..11534,11684..11732 ,11813..11878,12409..12458,12565..12689,12897..13006))


exon

Literature and cross-references EguAPx11
Protein sequence: EguAPx11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267
PWM (Da):   %s   29268.06  
PI (pH):   %s   7.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVVDAEYLKQIEKARRLLRALILSKQCAPIMLRLAWHDAGTYDATTKTGGPNGSIRNEAELRHGSNSGLEIAVDLEGVKASCPKISYADLYLAGVVAVEITGGPSVRFVPGRKDSVESPGEGRLPDAVKGENASHLRDVFYRMGLSDKDIVALSGGHTGRAHIDRSGFDGPWTKEPLKFDNSYFVELLKXYSPGLLRLPSDRVLVEDTEFRPYVELYADEEAFFKDYARSHKKLSELGFTPDYMGLMLAKLKLAFTSARGH*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_10_35034 (13006..10779).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGGTCGTGGACGCGGAGTACTTGAAGCAAATCGAGAAGGCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTAAAGATTC
TCGTACCCTTTCTCTTCTTTCTTATTATGCCTTTCTTTTTGGCGAAGTAATGTCTGTTTGAAGGTTGGTGAGTGATGAAACTTGTCGGATTGCGAGCGACCGGGGGCGCATATGCGGTGC
TTTGTAGTGTTTCGCGTAGATTGCCTGTTTAAGACTTCTCAAATAATGTTGGCGCATGATGGTCATGAAATCTGCAGGTGGCACGATGCGGGCACTTATGATGCTACAACAAAGACGGGA
GGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
GTGGGCTTCTGCGGCTTAGCACATATAACTTACCACAT
TCACAAGTTCATTCTACATTTTCTAGGNACGTCTTTCTTCAAATCTTTCTACTTCTATTTTGTTTCAGAAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAGGT
TACTGTCTTTTTCATGAATTTTTGCCTTCTTGGTTAAAAGTTAAATGATCTTCTCAGTTGGTGACATGATAAAGAAATATGTAAACCAGCACATAGGTCACAGTGTGCTGCACATGGAAA
GAAATCTTTGAGACTATTGATGAACCTGTACTGCACAAATTCCACAGCCTGATAGTTTCAAACTTTGCTACTCTTATCTGGGTTTGATGTTAGCTACAGAGAAATCTTGCAGATGTGGTT
TCTAAGATGTTAAGGGTGTTATCTGACATTCCATGTGNGGAGACTTACCCATGCTTACTTTGGATGAAGACNTCGTGGCTANTTATTTTCTGGCTGTGTTGACTATTTTGCTCGCATTAA
TCATTATATCTCCAGGGACAGTCTCCAGTTGTTTAATAGCTTTGTGTTGAATTGCTTTTTATGGTAACTGATGAGCAGCTAGAGCAGTCTATGTAAAAATTCAAGCTCAAGAGGCAAGAA
TTTTCAGATGTTGTGAACTCACAAGTTCAGCCATAATTTGTTTTTCAGCTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGTAAAA
TTGGCAGAAAGAATTCTTGAGGCCTAATGGTTTATGCATCATCACTTATATCGACCGAGTCATTTCTATATTAGGATTCTGTGGAGTCTCCAGGGGAAGGACGTCTTCCAGATGCTGTTA
AAG
GTACGTATCACTAAAACTTTAAGTTTAACAATTCTTAAGTGGTTTGAACTGATGACACCCATATGAAAATGATACCAGCTTGTATATTAGCAGTGAACCTCAGACTTTCCACAATGC
TCTTAATGTAGTCCTTGTTCATCTTAATACAGGTGAAAACGCTTCGCATTTAAGGGACGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTT
G
GTAGATATTTCAGAAGCCCTAAACTGCTTCATACGAGTCCTTCCCTGCGGTACCAGCAGTTTGTGCATATTCCGATTTCTTCCTTTTCTTCTCTGAATTTTCAGGGAAGGGCACATATA
GATAGATCAGGCTTTGATGGACCCTGGACCAAAGAACCCCTTAAGTTCGATAATTCTTATTTTGT
GTAAGAGATGATCACACTTCGATGCAATTCTCTCTATTCAAACTCTACTTCCATC
AGATGAGCTTTCTGCACAATGCTTGCGCAGGGAACTTCTGAAAANATACTCACCAGGACTTCTGCGACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCGTCCCTATGTCGA
GCTATATGCTGAG
GTACACTATCGATCTAACGGGGGGCTTTGGAACATCTTGTCTTTTAAGTCGTGCTGTAAGAGGCAGTACATGTCCCCTATGGAAGTTCATCATTCTTTGTGCTAGTT
TCTTCTTTGTGAGAGAGTTTTCTTTATGTTCTTTTTGGTTTCTGAGCGACATGCAGGATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTGTCCGAGCTAGGCTTTA
CTCCGGATTACATGGGCTTAATGCTAGCAAAGCTCAAATTGGCATTTACTTCAGCCCGGGGTCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGGTCGTGGACGCGGAGTACTTGAAGCAAATCGAGAAGGCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTGGCACGAT
GCGGGCACTTATGATGCTACAACAAAGACGGGAGGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
AAGGA
GTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAG
CTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGATTCTGTG
GAGTCTCCAGGGGAAGGACGTCTTCCAGATGCTGTTAAAG
GTGAAAACGCTTCGCATTTAAGGGACGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGC
CATACTTTG
GGAAGGGCACATATAGATAGATCAGGCTTTGATGGACCCTGGACCAAAGAACCCCTTAAGTTCGATAATTCTTATTTTGTGGAACTTCTGAAAANATACTCACCAGGACTT
CTGCGACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCGTCCCTATGTCGAGCTATATGCTGAG
GATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTG
TCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCAAAGCTCAAATTGGCATTTACTTCAGCCCGGGGTCACTGA

Retrieve as FASTA