Entry information : EguAPx[P]02
Entry ID 11387
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2013-01-22 (Qiang Li)
Peroxidase information: EguAPx[P]02
Name EguAPx[P]02
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx[P]02
start..stop
S start..stop
EguAPx[P]05 164 1e-54 1..78 1..78
EcamAPx[P]05 159 1e-53 1..78 1..78
EgrAPx[P]02 157 6e-53 1..78 1..78
EglAPx[P]06 157 3e-52 1..78 1..78
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6734..6784 51 N° 2 6568..6647 80 N° 3 6376..6478 103  
complement(join(6376..6478,6568..6647,6734..6784))


exon

Literature and cross-references EguAPx[P]02
Protein sequence: EguAPx[P]02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   78
PWM (Da):   %s   8559.32  
PI (pH):   %s   4.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSDKDIVALSGAHTLGRAHQERSGFDGPWTQEPLEFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYA

Retrieve as FASTA  
Remarks Pseudogene from genomic. (Just 5' end).
scaffold_5_14900 (6784..6376)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTGTTATTTT
TTTATTCTTGTGTCAAGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTGAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACTGG
ATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGC
ATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTGAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA