Entry information : EguAPx[P]04
Entry ID 11388
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EguAPx[P]04
Name EguAPx[P]04
Class Ascorbate peroxidase     [Orthogroup: APx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx[P]04
start..stop
S start..stop
EgrAPx[P]04 334 2e-119 1..182 1..182
EglAPx09 324 4e-114 1..182 107..287
EgrAPx09 324 5e-114 1..182 107..287
EguAPx09 323 1e-113 1..182 107..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11361..11396 36 N° 2 11473..11521 49 N° 3 12408..12490 83 N° 4 12577..12656 80
N° 5 12746..12848 103 N° 6 13424..13621 198  
join(11361..11396,11473..11521,12408..12490,12577..12656,12746..12848,13424..136 21)


exon

Literature and cross-references EguAPx[P]04
Protein sequence: EguAPx[P]04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182
PWM (Da):   %s   19810.24 Transmb domain:   %s   o153-175i
PI (pH):   %s   6.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGPTIDFVPGRKDSRVSPNEGRLPDANQDPPRLRDIFYRMGLSDKEIVALSGAHTGRKHPERSGFDGPWTQEPLKFDNSYFVELLKGDAEGLLKLPTDKALLEDPAFRPYVELYADEDAFFRDYAISHKKLFELGFTPSSSGSKTVANGAVLAQGAVGVAVAAAVVXILSYFYEVRKKMK*

Retrieve as FASTA  
Remarks Pseudogene from genomic (7 exons, the two first are missing). Scaffold_3_9851 (11361..13619)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAGGTCCCACAATCGACTTTGTTCCTGGAAGAAAGGTACTCTGTTTTAGCTGTATGTGAGCAAGATAATTCTTACGAGTGCCTTATTCATTAAGTTTTTTTCTATCTGCAGGATTCAAG
AGTTTCTCCAAACGAAGGAAGACTTCCAGATGCTAATCAAG
GTATTTTGTTGTGTCAACTTTCCCTTTGTTGTTTGGCCTCCCTTTATTTCCCTCCATCCCTCCCTCTAAATATTATGGC
CTACCGTGCTTCTTGTTGCTCCAGGCGAAAAGTTAAATAACTATTTATTGTTTTTCTTATGGTTGTGGCCTGTTAGTATTGAAATGTATGTCCATCTCATCTGAATATCAATTAGTAAGT
TTCCAGAGGAATGATTTGAATGAGATAAGAAGCGCAGTGGAAAAAGAGGTATCGGAGCTAACTGACATTCGGATGTTGTACATCCCATCTAAATGTCAGTAAGTTTCCAGATTAAGAACT
GCACAAGCAAAATGGGCACAGTGCCTGTTTCATATGAGTCAGCTGTTGTGAACTCACTACGAAGAATGACTTGAGAGAGAAGTGCTGGGATTTGAACTCTTGATCTGTCATATGAAACAG
TGCTAGAATACCCAACCTAAAAGTTTAAGCTGTGATGTGGAGAGAGACAACATGTATATAAGAAAACTGAGCCATTAGGTGAGAGAGACTATACGTGTATGAGACTCATTATGACCACGT
TTTCAGGGGATGTTTGATTATATTAAAAACAATATTACTACTCATGCAAACCCAGTTTGATATTTCACATGATATTTTACATCTGCAACTCACTGTAGCTGATCGAAAGGAGGCTCAAAT
GAAAGGAGGCCTTCAACCGCAGCTTGGTTAAGCTTATCGATTTGTGATATTCACGTTTAACAATCCACTGCCTATCCATAACTTATCATAGCTCTAAATCCATAGGAGATCTTTCATGCG
TTATAATTCTCTTATTGGTGAAATACACGTACATTTTGCTTAAAGGGCATTCGAAATTTTTTCTAAACTTGTCATTGCTGGATGTAGATCCTCCACGTCTAAGGGACATCTTTTACAGGA
TGGGTCTCTCGGACAAGGAAATAGTGGCCTTATCAGGGGCTCATACACTG
GTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGCAACCACACTTGTTATTTTT
TTATTCTTGTGTCTAGGGAAGGAAACACCCGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTGTAAGGTTTCATCTTTTCACTGGA
TGCATTTTCTAAGTTTCGGTTGGAGCATTATAGAGCCAGATGCTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGACGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCA
TTGCTGGAAGATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG
TAAATAAGCTTTTCGCGTGGTCTGGTGACTCCATTGATAAATCTATAAAATCGAATTGCAGTTACATGTTTT
CTTTTTGTAAATTTGTTTTTGATGAAACTACCCCGCCACACCACTATTTCGTTTCCTTATGCACCCGGTCTATAACCCTTTGATGCTACTGTCCTTGTTTTTGCCGAGAATGAAAAGAGA
TGGAAAGTGTTTTTCATGGAATTTATGCTGTGTAGGCTTGTGATGCTTAAAAGTAAGCATTCAGTCTGTTCCATCACTATCTTCTATGTAGAGACCAGGAAATATTCATAATGAGATCGC
ACATCAAATGTTGGGNNNATACAAATATATGTTGGGATGGATATATTATGTGGTTCCCTGAAACCTCTAGGCTAGAGCATCATTTTTGTGCTACTGGGAACACCTGATTTGATATTTGAA
TTGGTTGTTGTTCCCGCAACTCTCTCATGGTGGTTGGCACGACCTTGAAAAGAGACAAACGGACAATTTGATGCTGTGCTTTTTTTCCTCGTTTTCTTTTGCTATATGCTCTTCTTTCCC
TAATGTTGTCAAGCATGTGGCAGGATGAGGATGCATTTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTTTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGACAGTAGCGA
ATGGTGCCGTATTGGCACAAGGTGCTGTTGGAGTGGCAGTGGCTGCGGCTGTGGTGANNATCTTGAGCTACTTCTATGAAGTGCGCAAGAAAATGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGAGGTCCCACAATCGACTTTGTTCCTGGAAGAAAGGATTCAAGAGTTTCTCCAAACGAAGGAAGACTTCCAGATGCTAATCAAGATCCTCCACGTCTAAGGGACATCTTTTACAGGATG
GGTCTCTCGGACAAGGAAATAGTGGCCTTATCAGGGGCTCATACACTG
GGAAGGAAACACCCGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCC
TATTTTGT
CGAGTTGTTGAAAGGGGACGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAGATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAGGATGAGGAT
GCATTTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTTTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGACAGTAGCGAATGGTGCCGTATTGGCACAAGGTGCTGTTGGA
GTGGCAGTGGCTGCGGCTGTGGTGANNATCTTGAGCTACTTCTATGAAGTGCGCAAGAAAATGAAGTGA

Retrieve as FASTA