Entry information : EguDiOx01
Entry ID 11389
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EguDiOx01
Name EguDiOx01
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguDiOx01
start..stop
S start..stop
EcamDiOx01 1295 0 1..632 1..632
EgrDiOx01 1291 0 1..632 1..632
EglDiOx01 1285 0 1..628 1..629
PtDiOx02 1083 0 1..632 1..632
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2204..2296 93 N° 2 2392..2652 261 N° 3 3599..3748 150 N° 4 3937..4070 134
N° 5 4758..4971 214 N° 6 5390..5535 146 N° 7 5663..5890 228 N° 8 6089..6291 203
N° 9 6375..6618 244 N° 10 6738..6963 226  
join(2204..2296,2392..2652,3599..3748,3937..4070,4758..4971,5390..5535,5663..589 0,6089..6291,6375..6618,6738..6963)


exon

Literature and cross-references EguDiOx01
Protein sequence: EguDiOx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   632
PWM (Da):   %s   71983.66  
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALISVFSSLIHPQLRPMVSKMSLFDALIFLVIHAVDKLGLWHRLPVYMGLAYVGMRRHLHQRYNLIHVGSVDGKKYDTQAFNYRTADGRCNHPSDDVVGSRGTFFGRNMPPSTSTYGLMDPHPSVVASKLLARKEFIDNGKQFNMIACSWIQFMIHDWVDHMEETDQVEIEAPDEVAEKCPLKSFRFNKTKKVSTGSSHLKNGSLNIRTPWWDGSVIYGNDDNGERRVRTFKDGKLKISGDGLLEHDEKGIPISGDVRNSWAGFSLLQALFINEHNTVCDMLKYYPDLDDEKLYRHARLVTSAVIAKIHTIDWTVELLKTDTLLAGMRINWYGFLGKKFKDMFGHICGPILSGLVGLXRPRDHGVPYSLSEEFVSVYRMHSLLPDKLILRDVNSTILERKCLPVAEEIPMREVVGRQGQRRLSKIGMEQMMVSLGHQACGALSLWNYPSWMRNLVPQDVDGEDRPDSIDMAALIYRDRERGIARYNEFRXNMLMIPISRWEDLTDDKQVIRALREVYGDDVEKLDLLVGLHAEKKIKGFAISETAFFIFLLIASRRLEADRFFTTNFNTQTYTXKGLEWVNKTETLKDVIDRHFPDMTRKYMRCSSAFAVWDSXPTPTSHIPLYLRHTP

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_11_37559 (2204..6963).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTACGTAACTCCCTCTCCCGCGAAACG
ATGAGAGATGTGGTCGACGAGTGATCTGGCTTTTGATTTCTTACTGTTGTTTTGGGTGTTTCGTGTAGGTGATACATGCGGTGGACAAGCTAGGATTATGGCACAGACTGCCGGTGTACA
TGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAGGCATTCAACTATCGGACGGCGGACG
GAAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
GTAAGCATGTATTATAGGTCTTCTGATTTAC
TCAGTCTATCAAATCAGAGAGGTTGAGTTTACGTTTATCTGTTTCTGCTTCTTAAAATCAGAAGTTTACATTACTTTAAAAAGAACAGGCAACTGATAAAAATGTCCTTAATGCTCATTT
GCGACGGCTTACTAGTCGTCGCCTGTGTCACCTGTATACTTTCTTAACTGGAGCTACTGACGGTCCAGCGAGCCGGTTGACACCAGTGACTGCTATCGGAGCCGTCCCTAAAAGCCGCAT
TAGGGGCAGTTTTCCTGTCCCTAAACTCGCTTGAGAATAATATCCATAAAAGAGCTACTTTTTTTCTGTCTTTTCCCGGCGGGGAGAGTAAAAACGTGCAAAGCTTTGATCATAGAAANA
CACCAATTCGATGACAATTATTCTCTCCAGTGCAGGAAGATTTATTAAAATTTCAAGTTAAAGGAGGAAATTTTTCTTTTTTTATTGAAAAAAACTAAAGTAAATTTTCTATCATATCGG
AGAAGATGAAAATGCAACTTCAGAAAGTTACCCAACCACAAGCCATTAAAGAATTCCAGCAGTCTCTCCTTTAGGTTTCTATCAATGGCCCACAGTCAAAATCTACTTATGGACTGCCAT
GGCTGGTCAGAAAAAAAATTCCACTTCCCAAGGGCCTCATTCTCTTCATTTGGTTTACCATTAATTTACTCAACTCATTAAGTGGGAGGCAGGCTATGGCCCTGTCACACCGCCCATGTC
CACGGATTAGATTTGTTCAGTTTCTGTCTGAAATGGCCTACAAATTTCATGAACTTGATTCTATCTCCGCTTGGAGAACAGCTGTCCAGTCTTATCTGTCAATCGTAAAGATTATTGTCT
TCTGATCGAATACCAAGTACAAGCATAGCCTGCAATACCAACAAAACTAATTTTGATCGTCTTCTTTTTCCACAGTTAATGGATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCA
AGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTGATCACATGGAGGAAACTGATCAG
GTACTAAATACAAAA
AAAAAATATAAAAAAACCCCATAGCCTCTGTATTATACAAGGCACAGCTTGATATTTTGTAGGAAAACAACCTCAGAATATTTTTGACAAACTCAAAATGGAGAAGTAGCCGAATGGATC
CACCAGTGGGGTCATCGCATTGAAGACTGAATGATCAATAATATCTTCGGCAGGTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGA
CCAAGAAAGTGTCAACCGGGTCATCTCATTTGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GTAAGTTCCTGCGAACAGTATTGTAATTACTCAGGACTACTAAACTTTAGGCA
GCCATTCAAAAAACTCATGTCACTGAAAACAAGTCTTTGCAGCCATCTGATTCATGATCCTTTTACGAGTTGAATGCAGAAAAAGATGGTGAAGAAAGATTTGGAAAAAAGATTAAGAAG
CAATGTTGTAGACAATATTTCAACCTCGCTGAGCCGTAAGACTCGGAATTCCCTGCTTTTTGCCTTCATCACCCGAACAAACTGAGAACTATGAACTTTCGTTATGCTGTCACCAGACAG
ATGTCCATATTTGTTCTCAGTTTGTTCTTAGATGCTGAAGAGTTCCTCAATAAAATGGAATGTGGCCTGGATAGAATAGTACTCTGAGGAAATTATGGAAACTACATACAGATATTCCAA
AATTTCGTTTATATACGCTAAAATTTGCTTACATGTAGGGATTCATCTAAAATTGATGTCACTATGAAGTCTAGTACTTCCAGTAAGGCAACTAAGCCAATGACTTAAGGTGTGATTTCA
TCTCAAAAGAAAAAAAAGTGGCTATCTGAGTAATGATTAGCTGATCTTAGTCAAAACTTCACCAGTTAACTTGTTACTGCTCTAAGAGTTTTCTCGAAGAATTGACATGAAGATGTGAAT
TTCATCAATGAGTTGTACATTGTAAACTGCTTAGGGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCGGGAG
ATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCATCAACGAACACAACACTGTCTGCGATA
TGCTTAAA
GTAAGGCCTCCCTTCTCTTCCACCAATCCAATGAAAAGAACTTCCTTATTAAACAATGCTGATCCCGAGTTTTCGATCGAGATCTGGTGAAATGTCCATGAACTCCTGATAT
CGTTGTTTCCAAATTCTTCAAGTCTATAAGGGCCGACACTTCTCTTGTCATTGTTATTTGCTTTGACGAAAAGTTAGCTCTGAATACAACTGCACATCTTTTACCTGAGGAACTATTATA
GAACAAAGAAGCCTGACATCTTTGATCATCGTCAGAACCATATCTCATATAATTACCCTGGCTTCATGCGTGCTATCCTTAGGGTTGAGCGGTATCAACATAACATTTCATTGAAAATAT
TGCCGGCACTCATATACCAAAGAAACTACAAGGATAGCTAATATTATGTACTTGTATATGTGTCAGAAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTAGTA
ACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGAAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTAATAAAGAGAGAAAAATGGATCTGAT
GATGAACGACTGGGGATTTACTAGTAGTTGTGCTAAAACTTACGCATAATTCTGTGATAATGCCGTACTTACTACTTACCACTATCATGCCTGGTTCAGGTACGGATTTCTGGGGAAGAA
ATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCANAAGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAG
GATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAACGCAAATGTCTGCCCGTTGCAGAAGA
GTAAGCATCTTACCATACCATTTGCATCTAATT
TCACTTTCTTCATGTTTGCTGTTACTGCCAAACTAAGGTCGTACTGACAAAAGCAAAGAACTTCGATCTCATGAAATAACAGATATATTGNCTTCTTCGGGAAATGGCTTTCAATTTTAC
TTCTAGAGGGACTACAGTCACTAATTGTTCTAGGAAAATTACTAGGATTCCAATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCGAAGATTGGAATGGAGCAGATGATGGT
GTCACTAGGTCATCAGGCATGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAATCGACATGGCAGC
NTTAGAAA
GTAACATGACTACTCACCTCATTTCTTTCGCACTGCTATATCAANGTGACTGCACTCGAACTGACGCTCGCATATTGGGCCAGTTTACAGAGACAGGGAGAGAGGTATCGCG
CGGTACAACGAGTTCAGANGAAACATGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTCTATGGAGACGATGTGGAGAAG
CTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTATTGATTGCATCCAG
GTAACTCTCATATCCCCAACCCAAT
TAGGATACCCTGGAAGTGTTGACCCTTAATTCCATAACGTCCTGGCTGTGCCTTCTAACTTCTTGAACCCTCGTTCTTGATAATTTTTTTCCAGGCGGCTAGAAGCCGACCGGTTCTTTA
CAACCAACTTCAACACACAGACATACACAGANAAAGGCCTGGAATGGGTAAATAAGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGACGAGGAAGTATATGAGAT
GTTCAAGCGCNTTCGCTGTATGGGATTCACANCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATACGCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTGATACATGCGGTGGACAAGCTAGGA
TTATGGCACAGACTGCCGGTGTACATGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAGAAGTATGATACTCAG
GCATTCAACTATCGGACGGCGGACGGAAGGTGCAACCACCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
TTAATG
GATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAAGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTT
GATCACATGGAGGAAACTGATCAG
GTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGACCAAGAAAGTGTCAACCGGGTCATCTCAT
TTGAAGAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAGAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCG
GGAGATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCATCAACGAACACAACACTGTCTGC
GATATGCTTAAA
AAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTAGTAACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTG
AAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTACGGATTTCTGGGGAAGAAATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCANA
AGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAGGATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAA
CGCAAATGTCTGCCCGTTGCAGAAGA
GATTCCAATGCGGGAAGTGGTGGGACGACAAGGGCAGAGAAGACTCTCGAAGATTGGAATGGAGCAGATGATGGTGTCACTAGGTCATCAGGCA
TGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAATCGACATGGCAGCNTTAGAAA
TTTACAGAGAC
AGGGAGAGAGGTATCGCGCGGTACAACGAGTTCAGANGAAACATGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTCTAT
GGAGACGATGTGGAGAAGCTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTATTGATTGCATCCAG
GCGGCTA
GAAGCCGACCGGTTCTTTACAACCAACTTCAACACACAGACATACACAGANAAAGGCCTGGAATGGGTAAATAAGACGGAGACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATG
ACGAGGAAGTATATGAGATGTTCAAGCGCNTTCGCTGTATGGGATTCACANCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATACGCCTTAA

Retrieve as FASTA