Entry information : OsPrx129
Entry ID 1139
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx129
Name OsPrx129
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx129
start..stop
S start..stop
PviPrx02 530 0 12..340 5..324
ZmPrx105 523 0 14..340 8..325
SiPrx162 512 0 30..340 24..325
ZmPrx142 512 0 14..340 9..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21940550..21940819 270 N° 2 21940017..21940196 180 N° 3 21939747..21939909 163 N° 4 21938513..21938922 410
complement(join(21938513..21938922,21939747..21939909,21940017..21940196,2194055 0..21940819))


exon

Literature and cross-references OsPrx129
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XC08
DNA ref. GenBank:   NC_008403.1 (21940819..21938516)
Protein sequence: OsPrx129
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (308)
PWM (Da):   %s   36083.95 (32893.2)  
PI (pH):   %s   5.89 (4.82) Peptide Signal:   %s   cut: 33 range:33-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQQRRGGGGVPRLAMAVAVLVLAASSAGRCRAQLASGYYAGKCVNGGGGNSSVAVDVESIIHDAVQARLAWDKRMVAGLLHLIFHDCFVAGCDASILLDGPNTEKTAPQNNGIFGYDLIDDIKDTLEKACPGVVSCADIIVAATRDAVGMCGGPRYEVQLGRLDGTVSQAWMAADLPGPDVDIPTAIDMFAKKGLNSFDMAILMGAHTVGVTHCSVIKDRLYNFNGTGEADPSMDPIYVWILTTFACPKSQAFDNIVYLDDPSSILTVDKSYYSQILHRRGVLAVDQKLGDHAATAWMVNFLGTTDFFSSMFPYALNKLAAVDVKTGAAGEIRANCRRTN

Retrieve as FASTA  
Remarks chromosome 10. No EST found. TC280662
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCAGCGGCGGGGCGGCGGCGGCGTGCCGCGGCTGGCCATGGCGGTGGCGGTGCTCGTGCTCGCCGCGTCGTCGGCGGGGCGATGCCGAGCGCAGCTGGCGAGCGGCTACTACGCC
GGCAAGTGCGTGAACGGCGGCGGCGGCAACTCGAGCGTGGCGGTGGACGTGGAGAGCATCATCCACGACGCCGTCCAGGCACGCCTCGCCTGGGACAAGCGGATGGTCGCCGGCCTCCTC
CACCTCATCTTCCACGACTGCTTCGTCGCC
GTACGTACAATCCATATACACACTGCTCTCTTAATCAAGATCAGTTCGATCAGCTAATTAATCAATACTGTATCTGAATCATCGCTGAAT
TAATCGATGGATAAATTTGTGTTCGATCTTATTATGATTAACTGATGAATGTATATAGGGGTTGTTCGGATTGATATCATTTCAAACCATATTATTTTTCTTAAAGTTATTAAATATGTG
CATCCATTTAGTTTTTTTACTAAACTCTGATAAATACACAGGAAATTTCGTCAAAACTTAACAATATTATTAAATTGTCAAAATTAGTAATGTACTATATTTTAACAAATTGGCTACAAT
CTGGACATGTGTGTGTGGTGCAGGGGTGTGACGCGTCGATACTGCTGGATGGGCCAAACACGGAGAAGACGGCGCCGCAGAACAACGGCATCTTCGGCTACGACCTCATCGACGACATCA
AGGACACGCTCGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCATCGTCGCCGCGACCAGGGACGCCGTCGGCATG
GTACACACACATTTCTCAAACCAATACTCCAATTCAT
ATTTGTCATTTCTGAATCGAAAATCCAAATTAAAATTTTGGCATTCTGCAAATTTGCGATGACGAAACAGTGTGGAGGGCCTCGGTACGAGGTGCAGCTGGGGAGGCTGGACGGGACGGT
GTCGCAGGCGTGGATGGCGGCGGACCTGCCGGGCCCCGACGTCGACATCCCCACCGCCATCGACATGTTCGCCAAGAAGGGCCTCAACAGCTTCGACATGGCCATCCTCATGG
GTAACTA
ACTCACTACTAATTCAACTTCAGAGTACTAATTAAACTTCTTCACAAAAAGAAAAACAGAGTACAAATTGAACTTAACTGTGATCGATTAACTGTTCTTTTTTTTTCAAAATCAAAGAAG
CTAGTAGATAACTAGGCCATGTGCATGTGTTTATACTTTAAGTACTTTGGCGTAATTTGACCGGGGGCAGAGCGCATCAGAATATATAATCGAGGGGCTAAACACATGGAATGTCACGTA
TACCGGTGCTACGCATTAAAAAGGGGTTCATGGTATCTGTGGGAGTACTTACTACCGTCAATCTCAATTAGCACTACTATACTCAGTTTCCTCATCGATCATGTTAATTTGTTTAATTAC
TTAAAGAATTCTGTTGATCGAGATCTGAAGCTATGCTTTATTGATCAGCTGGCACACATTGGTAATTGGGAAGAGTGAGATCCACAGCCGTTATCACACACACACACACACCTATATATA
AAAATGATGATACAGTGGCCACTGTGTTTAGGGTTACAACCTTTACAAAATCTTGGCCGTCAATTCCCCATCTGATATGACCATACTCTGTTTATAGTGTGTCTGCAAAGACAAGCTATT
AGCTTCTTGGTCATCAGTGACAACCAAATTTAGATTTTAAATTTAATATAGTCCATTTTGCATCATTACTTTTTAAACCGGTAATAACGTTTTACCCATAACTTATTCCGGTTACTTGGT
TCATTTCTTCACGGCTTATTATCAGGCATTGTAACATGGCTCAAACAACCATGCGTCTGTTCTAAAATAAAATTGCATCATGATATTATATGTGCAGGGGCTCACACGGTGGGGGTGACA
CACTGCTCGGTGATAAAGGACCGGCTGTACAACTTCAACGGCACCGGCGAGGCGGACCCGTCGATGGACCCGATATACGTGTGGATCCTGACGACGTTCGCGTGCCCAAAGAGCCAGGCC
TTCGACAACATCGTCTACCTGGACGACCCCTCCAGCATCCTCACCGTCGACAAGAGCTACTACTCCCAGATCCTCCACCGCCGCGGCGTCCTCGCCGTCGACCAGAAGCTCGGCGACCAC
GCCGCCACCGCCTGGATGGTCAACTTCCTCGGCACCACCGACTTCTTCTCCTCCATGTTCCCCTACGCCCTCAACAAGCTCGCCGCCGTCGACGTCAAGACCGGCGCCGCCGGCGAGATC
AGGGCTAACTGCCGGAGGACCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCAGCGGCGGGGCGGCGGCGGCGTGCCGCGGCTGGCCATGGCGGTGGCGGTGCTCGTGCTCGCCGCGTCGTCGGCGGGGCGATGCCGAGCGCAGCTGGCGAGCGGCTACTACGCC
GGCAAGTGCGTGAACGGCGGCGGCGGCAACTCGAGCGTGGCGGTGGACGTGGAGAGCATCATCCACGACGCCGTCCAGGCACGCCTCGCCTGGGACAAGCGGATGGTCGCCGGCCTCCTC
CACCTCATCTTCCACGACTGCTTCGTCGCC
GGGTGTGACGCGTCGATACTGCTGGATGGGCCAAACACGGAGAAGACGGCGCCGCAGAACAACGGCATCTTCGGCTACGACCTCATCGAC
GACATCAAGGACACGCTCGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCATCGTCGCCGCGACCAGGGACGCCGTCGGCATG
TGTGGAGGGCCTCGGTACGAGGTGCAGCTG
GGGAGGCTGGACGGGACGGTGTCGCAGGCGTGGATGGCGGCGGACCTGCCGGGCCCCGACGTCGACATCCCCACCGCCATCGACATGTTCGCCAAGAAGGGCCTCAACAGCTTCGACATG
GCCATCCTCATGG
GGGCTCACACGGTGGGGGTGACACACTGCTCGGTGATAAAGGACCGGCTGTACAACTTCAACGGCACCGGCGAGGCGGACCCGTCGATGGACCCGATATACGTGTGG
ATCCTGACGACGTTCGCGTGCCCAAAGAGCCAGGCCTTCGACAACATCGTCTACCTGGACGACCCCTCCAGCATCCTCACCGTCGACAAGAGCTACTACTCCCAGATCCTCCACCGCCGC
GGCGTCCTCGCCGTCGACCAGAAGCTCGGCGACCACGCCGCCACCGCCTGGATGGTCAACTTCCTCGGCACCACCGACTTCTTCTCCTCCATGTTCCCCTACGCCCTCAACAAGCTCGCC
GCCGTCGACGTCAAGACCGGCGCCGCCGGCGAGATCAGGGCTAACTGCCGGAGGACCAATTAA

Retrieve as FASTA