Entry information : EguGPx03
Entry ID 11390
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EguGPx03
Name EguGPx03
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx03
start..stop
S start..stop
EgrGPx03 449 5e-163 1..247 1..247
EglGPx03 380 5e-136 1..238 1..218
VvGPx01 350 7e-124 1..247 1..246
CsGPx01 342 2e-120 3..247 5..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14526..14813 288 N° 2 13877..13953 77 N° 3 13735..13796 62 N° 4 12419..12537 119
N° 5 12168..12335 168 N° 6 11716..11742 27  
complement(join(11716..11742,12168..12335,12419..12537,13735..13796,13877..13953 ,14526..14813))


exon

Literature and cross-references EguGPx03
Protein sequence: EguGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247
PWM (Da):   %s   26343.41  
PI (pH):   %s   9.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAPFSAAFSAPSYXFRRAGTNGNSPFPTSLWSPAALRVPSSIRSSLGSCNSAFLVNGLSSSSLQSSSRLSFSSRSSGVYARAATEKTLYDFSVKDIDXNDVSXSKFKGKVLLIVNVASKCGLTTSNYKELSHVYEKYKTGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDVXVNGPGTAPVYQFLKSSAGGFLGELVKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLLAA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_3_9764 (14813..11716)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCCCCTTTCTCGGCCGCTTTCTCCGCCCCTTCGTACNGCTTCCGTCGAGCCGGAACGAATGGGAACTCCCCCTTTCCGACCTCCCTTTGGTCGCCGGCCGCTCTTCGCGTG
CCGTCATCGATTCGATCCTCGCTCGGTTCGTGTAATTCGGCTTTTCTCGTTAATGGGTTGTCGTCGTCGTCCCTTCAGAGTTCGTCGCGGCTCAGCTTCAGTTCTCGCTCGTCGGGTGTT
TATGCTAGAGCTGCCACTGAGAAGACCCTCTACGATTTCAGCGTGAAG
GTATCGAATTTCTCTTCTGGGTGTAGCTGAAATTGGTATTTGGAGAGATCTTCTTTTTTGGGTCGTCAGGGA
ACTTTGTAATTCACTTAGATACGGTGTTTTTATGTATTTATTTATCTTCGGTAGAATCAAGCAATTCTGATGGCTTGCCCAAGCTACTTTGGAAATTAGAAAAAANANATATCTTAATTG
TCTCAGCCGCCACACTGTTTTTTGCATCTTCTCTGTTTTATTGTTACTTTTGGATGACGAGGAAGCACATTTTANCTACTTAACATTGGTGCTTCCAATTTGGANTAAAAGAAATCAAGC
TGGAGTTGAGGTCGCTTATTTGCTCTTTGTTCATGAATTGAACTAATTTGCAAATTCTCCACGGTATGCAAATCCTTAGAATTAAGATTCATGCTGTTGTGGCTAAAAATTCTTCGTTGT
TTTGGCACCTGCTATGTTTCGGTAATTTATGTGGACATTATTATACTATTCATTTTTCNGTTTACATACTGAATTTTGGGTAAAGCTGCTTTATTCATGATAATTGCTAATTGCTGCACA
CATTTTTCTTCATGGTTCAGGACATTGATAGNAATGATGTTTCANTGAGCAAATTCAAGGGAAAAGTCTTATTAATTGTGAACGTAGCTTCGAAATGGTAATTGCTTTATCTCCTTCAGT
TGTCTGATTTAATTTATCAGATGTACAGTCTCATTGAAGAATTTTCTTGTGATTCAGTGGTTTAACGACATCAAACTACAAGGAGCTCTCNCACGTATATGAGAAGTACAAGACTCAAGG
TGAGATGAGATTGTGAGGAGAGTTATAGAATTCCTTAAAAGCTTCTCCNGTTTGAAGTTAGACTACTATCTTTGAGCTAGGAGNGATCATTAATTTGTAAATATAGTAGATGAAATCATG
ATTCAGCAAAGGATGTGAATCACCTTATTATATCAGTGTCTTTTTCCAATCATNGGAAAATGTACAATATCAATGGAGTTTTGTCTGTCCTACACNCCAAAAGATTCANGTGGAAGTTCT
GTTCAAGTTCTCAAGACCATCTAATTAGGAGCTGAATTTCCCTTAACAACAAGTCACATCGATCATTATGCTTCTCACTTATAGTTTTTTTAATGATATGGGCTCCAACCAGAATTTAAT
CTTCTCAAGCAAGCTTTGNTTAGTTTGCCCTGTGGTACTGGGTCTTACACAGATTGCTAAAGGGATTGTCCAATGGTCTTTGCTGCGGTTGAGTGTNACAGTGTGCTAGAAATCAGTTGT
CCTTTATTTTTCCGTGGGACTTTTATCAGTGTTTTTTCCAGTCCATTTNCAGGTGTTATATTTTGTCAATCATGTTTGTTACATCTTCTTTTTNGTACTCTTGCACATTTACGAAGGGCA
CAGTTAGAGATGCTTCCTTTGTGTGTGTGTGTACGAGGGAGAGAGAGAGAGAGAGTAGTATATCCTGGATGGATGGATGAATGGATGGGGTGATAGGGGTAGAGAAAGAGAGATGTACCT
CCACTGATGAAAAGGAAGGGTTCTTTGTTTTGATGCAAGGAGAGAGACATAGAGAGGGAGAGGCCTATTGCCTCTACCGCAAGGGTGGGATGGCTGTTTCTTTGCTGGGATGGAAACAGT
GGGAGACCTCCACTGATGAAAGGAAAGGAGTTTTTTTTTTTTTTTTTTTTTGGNNNNGGGGGTGGGGGGGAGCTATATATTTTGCTATATCCGAGAGACAGGAAGAGATCCACTTCTTAG
AGAGTGAAATAAGTTCTTTGCTTTGATTCAAGGAGAGAGCTATAGAGAGGGAGAGACCTATTGCCTCTACTGGAAGGGTGGGATGGCTGTTTCTTTGCTGGGATGGAAAGAGTGGGAGAC
CTTTTTCCTCTGATCTAATGTATAGCTTGAATCTTCTATGCGGATTTGGATTTGGTTAGTCCTCTTTCTATATCTTTAAAATTGATAAGAAACACCTNGGGCTGTCCATGTTACAGGTTT
TGAAATTCTGGCTTTTCCTTGTAATCAATTTGGTGGCCAGGAGCCTGGTTCAAATCCTGAGATTAAACAATTCGCTTGTACAAGGTTTAAAGCAGAGTTTCCGATTTTTGATAAG
GTTTG
ACTTCCACACATACATTCTTTCCTCTATTTTAAGTGATGGCTGGAATGAACAACCAAGCTCAAGTCTGTTGGAAACAGGTTGANGTTAATGGACCAGGTACAGCTCCTGTGTATCAGTTT
CTGAAATCGAGTGCAGGAGGTTTTTTGGGTGAACTGGTCAAGTGGAACTTTGAGAAGTTTCTGGTTGACAAAAATGGCAAAGTTGTGGAGAGATATCCTCCAACAACGTCTCCTTTTCAA
ATAGAG
GTACGTTTTTTAAGCTAACTTGTGAAGTTCGGAGATATNCCTAAGTAATCGATGTTCTGAAGTATGGCAATTGCTTGCTATCATGACTGCATGGAGATGGTTACNGTCTTGTAT
GTTGTGTGACTGTATATCCGGTGTGCTTTTGTAATCGTTCACCATGCCGTTCCCATAGAAAAAGCTGGTCCCTATTCTTTCCCTTTCTGAGGCAGAGTTTTGTATGTTCATTGTAACTTC
AGTGNGTTCTCAATNCACTAATTCNCCTGGGTCACCGACNATGATAAGTTTTTACACCTCCCATTCANCAGAAAGGNGGTCTATATGTCANGTTCAATAATTCTAGAAGAAAAGACCAAC
AAAAGACTATCTTCAAGCCTCAGAATGATTTGAGNAGTTCTTTCGATTAACNTTCNCGAGTCTTCTTGCAGAAGGACATTCAGAAGCTTCTTGCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCCCCTTTCTCGGCCGCTTTCTCCGCCCCTTCGTACNGCTTCCGTCGAGCCGGAACGAATGGGAACTCCCCCTTTCCGACCTCCCTTTGGTCGCCGGCCGCTCTTCGCGTG
CCGTCATCGATTCGATCCTCGCTCGGTTCGTGTAATTCGGCTTTTCTCGTTAATGGGTTGTCGTCGTCGTCCCTTCAGAGTTCGTCGCGGCTCAGCTTCAGTTCTCGCTCGTCGGGTGTT
TATGCTAGAGCTGCCACTGAGAAGACCCTCTACGATTTCAGCGTGAAG
GACATTGATAGNAATGATGTTTCANTGAGCAAATTCAAGGGAAAAGTCTTATTAATTGTGAACGTAGCTTCG
AAATG
TGGTTTAACGACATCAAACTACAAGGAGCTCTCNCACGTATATGAGAAGTACAAGACTCAAGGTTTTGAAATTCTGGCTTTTCCTTGTAATCAATTTGGTGGCCAGGAGCCTGGT
TCAAATCCTGAGATTAAACAATTCGCTTGTACAAGGTTTAAAGCAGAGTTTCCGATTTTTGATAAG
GTTGANGTTAATGGACCAGGTACAGCTCCTGTGTATCAGTTTCTGAAATCGAGT
GCAGGAGGTTTTTTGGGTGAACTGGTCAAGTGGAACTTTGAGAAGTTTCTGGTTGACAAAAATGGCAAAGTTGTGGAGAGATATCCTCCAACAACGTCTCCTTTTCAAATAGAG
AAGGAC
ATTCAGAAGCTTCTTGCTGCT

Retrieve as FASTA