Entry information : EguGPx04
Entry ID 11396
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EguGPx04
Name EguGPx04
Class Plant glutathione peroxidase    [Orthogroup: Gpx2004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx04
start..stop
S start..stop
EgrGPx04 341 1e-122 1..170 1..170
EglGPx04 289 4e-102 17..160 1..144
VvGPx08 270 2e-94 1..170 1..170
PvGPx08 270 2e-94 1..169 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40414..40467 54 N° 2 39112..39188 77 N° 3 38760..38821 62 N° 4 37804..37922 119
N° 5 37374..37541 168 N° 6 37156..37218 63  
complement(join(37156..37218,37374..37541,37804..37922,38760..38821,39112..39188 ,40414..40467))


exon

Literature and cross-references EguGPx04
Protein sequence: EguGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19089.62  
PI (pH):   %s   4.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQLMQDPQPIYELXVKDEKGNDVSLGEYRGKVLLIVNVASKCGLTNSNYTELNQLYERYXDGLEILAFPCNQFGNEEPGTNNEIKEFVCTRFKSEFPIFDIEVNGEKEAXLYKFLKSGKWGMFKDDIQWNFAKFLVDQNGVIINRYYPTTSPLTIEGDMKKLLGISISMHIVLACV*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_4_13895 (40467..37156)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAACTGATGCAGGACCCGCAACCAATTTACGAGCTCNCTGTCAAGGTTTGTCCCATGAGTTCATCACCCACCTCAGAAATTTCAAACCTTTTCTGGATCTCTCCGTGATGT
TGGGTTCTTTCTTTGTCTGGCTTTGCGAGTCTGAATGTTTTCTGGGCACAAGCCCTTTCGCAACTAGCTTTGTGAAGCTTGTTCTTGAACCGAACTGTTTCGATGANGAGCTTAATAGTG
GTGATGAGNATGTTCCCTTTTGGACGATCGGCCGTTTGTTTGGGATTCTTGAATCGGCCCGACTATTATTACTGTCGGAAACATTGAAAGATTGCATCTTTGGTGTGAATGGGTGATGAA
AAGCTAGTTGACTCTGTGTGGCAGTATTTGTNGGGAGCTAGCTGAATGTTCTCTGGNCACAAACTCTTTCGCAAGTTCACTAGCTTTTTCGCAAGTTCACTAGCTTTGTGAAGCTTGCTC
TNGAACCGAACTGTTTCGATAAAGAACTGAATANTGATGATGATAATGNTCCCTTTTGGTGGATCAGCCGTTTGTTTGGGATTCTTGAATCGGCCCNAGTGTGATTATTGTCNGAAACAT
TGAAAGATTGCATCTTTGACTTGAATGGGTGATGAAAAGCTAGTTGACTTTGCGTGGCAGTAGTTGTTGAGAGCTAGTTGAATGTTCTCTAGGCACAAACTCTCTCGCAACTTCACTAGC
TTTGTGGAGCTCGTTCTTTGACTGAACTGTTTCAGTAAAGAGCTTAATAGTGGTGATGATAATGTCCCCTNTNGGAGNATCGGCCCATTTTTTTGGGATTCTTAAATTGGCCCAAGTATG
ATTATGTTGGAAACATTGAAAGATTGCANCTTTGATGTGAATGGGTGATGAAAAGCTAGTTGACTTTGCATGGCAGTAGTTGTTGAGAGCCAGAGGATACTTGATATATTATATTGAATC
ATTTTTGTTGTCGCTGGTGAGAAANNGTGGCGAANAGATCAATNTTGGGGCCAACTGAATGGCAGGAGGTCCTTTTGTGCTTNTTTCCCTTTNCAGATNTTGCATTCTAAAAGGGTCTCN
TTTTAGCCTGTTCCTTCATTTTGATATGTATATTAAGAATTAGACATTTCGCAGTCTCTTCCTGCTGCACTAGTTCAATTGGGGTGACCNTTCTGGCATCTGACTGAAGATAATGTTTTT
CATTCCCCCATTATATGTGAACTTGATGGAGCTTCTTCAGGCAATAAATGTCTAAAGCTTNTAGTTCTTTAAAATGCAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGG
GAAGGTCTTGCTTATTGTGAATGTGGCCTCGAAATG
GTATGTACCTTATCCACCTTGTCTTTGTTCTGTCTCTTGTTACCNAAATTNTACTGAGGAAAACAAATATGATAGTGGATCTGA
GGAAGAGAGATTTTGTNGAAATACGAAGAGAAGGGAGNGCATGGTGATTNTNGTTAGCNTGAACCTTTGAATTCNGAGATATTGTTATGGAGATGTGATGCNTTTANTAGCTTAGTTTCG
TTTTACACTTCAANAGCTCACCAAATGNATATTCTCTAGATTTTCCCTGTAAATATATTTACTCAATTGTCGTTTGGTTTTGGCAGTGGATTGACTAACTCAAACTATACCGAGCTAAAC
CAGTTGTATGAGAGGTACANAGATAAAG
GTGAGCTCTTCAAACTCCANGTTTGAGTTCCCATCTTCCTTAGGTGACTAATCCACCAGGGCTGCAGAAGTTGGAATTTTAAAGTAATGGTT
TGTCAATTCTAATCCTTGGTATAAAACTATACTCTGGAGTATGGTGCTGAGGATGGAAAAGAGCTGNGGTACTACTTCACNGGTTGAGTGGATCTGAGTTTTTGTCATCAACCTTCGTGG
ACAAACCTCTCATTCNTTCCATCTTCCATTCTTTGGTTTTAAAACTGGTTGAAAACTTTCACAATGATCTCTTAACTTATGGTGCTCACTCTAGCTGTTATCATCTTAGGGATGATCTTA
TTGTAAGCATAGTCTTTATCGGCCACTCTCCAACACCTTTTCACATCACTACCAGTGTTNNATTTTTTGTATNGCCTACACTTCTGATGCTCTGAAGATGAATGTTCTCCATCNACTTCT
TTAGATGAAGTATTCTCTTACTTTNTAGAGCTGGCTCTGGTNAAAAAAATCTAACCTGCNGATCTTGGAATGTGACATTTACTGCTAATATTTATGTCAGCAAGGGGAAAAAGGAATAGA
AAGATCAATACTCATATGTTTGGTCCTTCATTCTCACTTCATTGNCCTAATATATATTTCTATTCTCCAATTTGCAATACTCCGTTTGCAAATTATGAGANTTTTTCTTGTGTTAGCTCT
ATTTCCTTTCCAGTTTTACTATGCACATTTGATTTGTGACAGTACTAGATGTTCGGTGGCATAGAAATTGATTATCCTGAACCAGAATTGTGAGAAGGTAATGCTTGAGTGACATTGGGT
TTTCCTGATAAGTGAATTGGTGCAGGCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAACCAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAG
TCAGAATTTCCCATCTTCGATAAG
GTCTACAGGCAATGTTTTTGGTCTCCTACTTTCTGAAANCCTTGTTTAGACACAAATTTAAGTTANAATGGCTTGACCGCCCCTAAGATGTAAATG
CCTCATTATATTNAAGATGCTGCTTGAACACTTAGTTTCCTTTNTTCGCATAATTATCACCACCAAAATCTTGAATAGTTTCTTTCTTTTCCAAATTCTGTATTTGTGGTCTGAGGNCTG
GTTCAGCAACAAGGAATGAACATGCGACTTCCTTTTCTTTTCTTAGATCGAAGTGAATGGGGAAAAAGAAGCNNCACTATATAAGTTCCTGAAATCAGGGAAATGGGGAATGTTCAAGGA
TGATATTCAGTGGAACTTTGCCAAGTTCCTGGTAGATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAG
GTATACCTGCTTACAGATCATGTTTT
TCTCCAATTGATGCTGAGGGATCATGTGGTCTATATTTGATCANAAGATGGTCTCCTAGATGTGCTTGAATAATGAAAANNCTTTAATGTCCATTTACTAAACTAATGAAACAATGTCCG
CGGCTGCAGGGGGACATGAAGAAGCTGTTGGGAATTTCAATATCTATGCATATTGTGCTAGCATGTGTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGCCAACTGATGCAGGACCCGCAACCAATTTACGAGCTCNCTGTCAAGGATGAGAAGGGAAATGATGTAAGTCTGGGTGAATATAGAGGGAAGGTCTTGCTTATTGTGAATGTG
GCCTCGAAATG
TGGATTGACTAACTCAAACTATACCGAGCTAAACCAGTTGTATGAGAGGTACANAGATAAAGGCTTGGAGATACTGGCCTTCCCATGCAATCAGTTTGGTAATGAGGAA
CCAGGAACAAACAATGAGATCAAGGAATTTGTTTGCACCCGCTTTAAGTCAGAATTTCCCATCTTCGATAAG
ATCGAAGTGAATGGGGAAAAAGAAGCNNCACTATATAAGTTCCTGAAA
TCAGGGAAATGGGGAATGTTCAAGGATGATATTCAGTGGAACTTTGCCAAGTTCCTGGTAGATCAGAATGGGGTGATTATAAATCGTTATTACCCAACGACATCTCCTCTTACCATTGAG
GGGGACATGAAGAAGCTGTTGGGAATTTCAATATCTATGCATATTGTGCTAGCATGTGTATAG

Retrieve as FASTA