Entry information : EguGPx07
Entry ID 11397
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EguGPx07
Name EguGPx07
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx07
start..stop
S start..stop
EguGPx06 353 7e-126 11..203 32..250
EgrGPx06 351 6e-125 11..203 32..250
EglGPx06 315 1e-110 11..203 32..249
EgrGPx07 310 9e-109 11..203 33..244
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2183..2413 231 N° 2 3444..3504 61 N° 3 3676..3794 119 N° 4 3971..4138 168
N° 5 4230..4262 33  
join(2183..2413,3444..3504,3676..3794,3971..4138,4230..4262)


exon

Literature and cross-references EguGPx07
Protein sequence: EguGPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   22208.34  
PI (pH):   %s   9.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SSSPSSSALPFPIPFSPSVAQQTLLSPRPISSLPPPGPPIKPPPPFGCRSFVSRDRRSSRAMASQSSKGSIYDFTVKGLTNSNYTELSQVYEKYKNQGLEILAFPCNQFGAQEPGTNEQIVEFACTRFKAEYPIFDVDVNGENADPVYKFLKSSKGGLFGDNIKWNFSKFLIDKEGNVVDRYAPTTSPLSIEKDIKKLLGVA*

Retrieve as FASTA  
Remarks Partial sequence from genomic (PS is missing).
scaffold_5_14755 (2183..4262)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTCGCTCAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCCCGCCCGGCCCGCCGATC
AAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGCCGTGCCATGGCGAGTCAGTCCTCGAAAGGGTCGATTTACGACTTCACCGTCAAG
GTCGGTTCT
CTCTCGAGGTTTCCCTTTTGTGATTTCGCGGGGGAACTGTGAATCGGGAGTCGCCCATCGGCAGAAATGTCGACCCATATAATAAAGTTCTCCTCCTTTTTTCTTTCAAGTCATTTCTGA
GCGAAGATTTTGTTTTTTTATATCCACAGCGATGCTTCGATTTTATGTAACTCAGAAAGATGAAATTTTTATTCAATTGGTGTCGAGACTTTCTTGTAATCTATGTAAAGCTGAGGCCTT
TTTCCAAAGCCCCATATCAGAAATGTTAACCTCTATTATAAAGTTCGCTTTTCTTTTTCTTTTTTTGGGTCATTTCTGAGCGAAGATTTTGTTTTTTTATATTCACAGCGACGCTTCGAT
TTTTTTAGCTCAGAAAGATGACATTTTTATTGACTTGGTGTTGGGACTTTCTTGTAATCTATGTAAAGCTGAGGCCTTCCAAAGTTCTTTCTGTAGCCTTGTTTTTGGAGGTTTTTGAAA
GTTTAGGTGGTAATCTGAAAATGGACCAATCTACGGCACCTTTGATGTATAAGTTTCCCTTTTATCTATGTAATTCGCTCAAATATCGGATTTTGTTGATTGAAATATCGAGTTTTGAGT
AAGTTGTTGGGGTAAGTTGGTCAGGGAGCGAGATCATGTGTGTCGTGCCGTGTGCTGAGAGGTTGTGAATCNTTTGAGGACCATGATGTTATGCTGTGCTGAGACTTGGAGATTCGGGTT
CCTTTTTTTATTCAGGATGCTCGAGGAAATGATGTCGATCTCGGTTCCTACAAGGGCAAGGTCTTGCTGATTGTCAACGTCGCTTCGCAGTGGTAATTCTCAGGANTGTGTTTATGCCCC
GTAACAGGGAACATCTGGTTGGACTTTAATCTTGGCCGATCTGGTTAAAAGCAATATCATATTTCATGCCTTTTATCATTTGGAATTCCTTATGCAATTCAGCTTGGGAGTAGCTCAGTG
NTTTAGTAATCGGGTTGGTCCACCGTGTTCTAATTTTTTNTATCGGTATGTTTGTTGCAGTGGACTGACCAATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCA
AG
GTCTCCTATGCCTCCCCTGATGTCCCATAGTATCTCGTGTTTTAGTGGAATCCTGGCCTTAACAGGATAATAAAGATATATCGTATCAGAAAAAGCAGTTGGTTATTGGTATCACTTA
GCATATGGAGATTCTAGAAAATTTAAAGAGGATGTCACTCTGATGTGATGCAGGGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAGCCGGGGACAAATGAGCAGAT
CGTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTAAAAGATATACATGAGGTCCTTCTCTGAANATGAAGAGCATATGGTGAACTATCTCNCAAGAGTTT
TTTGGAGTCGTATCTGCAGTTCCCTTATATTTCCTAGCAACTGGCAATTTGCAGTTTGAATTTAAAAAAAAAAAGTGAGGATGAAGAATCTGATTGCTTTTTCTATAGGTTGATGTGAAT
GGTGAAAATGCTGATCCTGTTTACAAGTTCCTGAAATCAAGCAAGGGCGGACTCTTTGGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTTGAT
CGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
GTGAGAGTCTGATCGTTGACGATCATGGTCGAAGTTTGTTGACTTTTTTTTTGGCTATTTGACTGAGGCATTGCGGCTGTTATT
ATCGCAGAAGGACATCAAGAAACTGTTGGGAGTGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTCTTCTCCTTCTTCTTCTGCTCTGCCGTTTCCCATTCCCTTCTCTCCTTCGGTCGCTCAGCAAACCCTTCTCTCCCCTCGCCCAATCTCGTCGCTCCCCCCGCCCGGCCCGCCGATC
AAGCCGCCGCCGCCTTTCGGTTGTCGGAGCTTCGTCTCGCGCGATCGGAGATCGAGCCGTGCCATGGCGAGTCAGTCCTCGAAAGGGTCGATTTACGACTTCACCGTCAAG
GGACTGACC
AATTCAAACTACACTGAACTCAGTCAGGTCTATGAGAAATACAAGAATCAAG
GGTTGGAGATATTAGCATTCCCATGCAATCAGTTTGGAGCTCAGGAGCCGGGGACAAATGAGCAGATC
GTAGAATTTGCTTGCACTCGATTCAAGGCTGAATATCCCATTTTTGATAAG
GTTGATGTGAATGGTGAAAATGCTGATCCTGTTTACAAGTTCCTGAAATCAAGCAAGGGCGGACTCTTT
GGGGATAACATTAAGTGGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGTTGATCGCTATGCACCCACTACTTCTCCTCTTAGCATCGAG
AAGGACATCAAGAAACTGTTG
GGAGTGGCATGA

Retrieve as FASTA