Entry information : EguKat02
Entry ID 11398
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-01-17 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-17 (Christophe Dunand)
Peroxidase information: EguKat02
Name EguKat02
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat02
start..stop
S start..stop
EglKat02 1021 0 1..492 1..492
EgrKat02 1016 0 1..492 1..492
PpeKat01 946 0 1..492 1..492
NtKat03-1B 943 0 1..492 1..492
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 331..345 15 N° 2 680..776 97 N° 3 1304..1581 278 N° 4 1931..2707 777
N° 5 2914..3003 90 N° 6 3524..3591 68 N° 7 3666..3759 94 N° 8 3903..3962 60
join(331..345,680..776,1304..1581,1931..2707,2914..3003,3524..3591,3666..3759,39 03..3962)


exon

Literature and cross-references EguKat02
Protein sequence: EguKat02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   493
PWM (Da):   %s   56632.08  
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAHDSSFWTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLLEKIANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSXVIHERGSPETLRDPRGFAVKFYTRGNFDLVGNNFPVFFIRDGMKFPDMXHALKPNPKSHIQENWRIVDFFSHHPESLHMFSFLFDDVGVPQDYRHMEGFGVNTYTLLNESGKAHYVKFHWKPTCGVKSLLEEEAIRVGGSNHSHATKDLYDSIAAGNYPEWQLYIQVIDPDHEDKFDFDPLDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHDGLMNFMHRDEEVNYFPSRFDSVRHAEKFPMPPPVLNGKRDKCMIEKENNFKQPGERYRSWAPDRQDRFIGRWVETLSDPRVTQEIRSIWISYWTADKSLGQKIASCLNVRPSM*

Retrieve as FASTA  
Remarks Complete sequence from NGS.
scaffold_6_20847 (148..3962)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGGTATCGATTGGCCCTTTTCCCCTTTCCCGCTTCGAATCGTCGGATCTTCTGATCTTCGCGGGCGGTGAAATTCTTTTTGTCCCTTACGTTTTGCGATACTTCTGA
TGGGGCTGATCTTCGCTGATCGAGCGGGAATTTTCGAGTTGTTTCGCGTCTGTAAAGCTCGATTCGTTTCCTAGTTTCCGAGAATTTGGAGAAAGAGTACTCCCTGTTGGGATCCATTAG
GGAATTGTTCGTGCTAGGGCTCTGTTTCGTCGATTGTCGGATCTTTATCAGTCGCACGCGACCGTTGCTAAATTGTTGATGTTTCCGCTGCGAATTGTGGATGTCGCAGTATCGTCCGTC
GAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACTCATCCCTGACGGTTGGAACTAGAG
GTACGATTACCTCTACGGATCTCAGAGCTGTTTT
CTTTACCAAAAGATATGTAATTCTACGCTANTTGCACTTCAAAGGGGGCGTTTGTTAAACTTTTGCTTTTAATGGTTATGACATGGGAAATTGCTAGGCCAAGCACTTTTTGCATTCTTG
CTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAACCTCTTGAGGCCTAGATTGATCAAGCTGACAATGCATAGAAAAATNTGAT
AGAAAATGCAGTAATTTTTATTTCACAATCCAGAGGCACAGTCGTGGACACTCAGCTACCTGTCCTGCAAATGAATTGGTTCAGTGCAGGCCTCTTTGGCCTATGTATGTGTCCCTCACC
CAAAACAGAAAAATGTTAACAGTAATTTAGCTTATCTCGGAGGCATACTTTTTGTTATCCTTAAGCTTTCCGAACATATTTGTCAAGATACAAAGCTTAACAGCATTTAAACGAAATTTN
CTTTTATTTACAGGTCCTGTTCTCCTCGAGGATTATCATCTGTTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGA
TTTTTCGAGGTCACTCACGATATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCNCTGTCATCCATGAGCGTGGCAGCCCT
GAAACCCTTAGGGACCCTCGAGGTTTTGCAGTAAAGTTTTACACCAGAGAG
GTATGAGATGATTGCATGTTTTAGAATCTGCAAATTTATTCTTTTCATCTTCCTTNGTTGACCAGAAGT
GTATTTAGTTTACCGATGATCCAGATACAGTGTAGAATTCAGTAGAGTGTTGGCGTCTGTGCTTTAAATCCATGCAGTTCTTAACCATGTGATGATGGATTTTATCTTGACACTTCAACA
TGATTAGTTGAAGATGACTTTATCAAAGAGCTGTAATACAAAATTTTATTTCAATTACAAGAGAAGTCAGAACATCAAAATAGAATTAGTGTTTCTTCACGTAATTGTGTGGTTTCTCAT
TTTTCTTCTTTTCTTTGACCATTTGTTTTTCTGAATGCAGGGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTATTCGCGATGGTATGAAATTTCCAGACATGNTCCATGC
TCTTAAACCCAACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCA
AGACTACAGACACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGA
GGAGGAGGCAATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGA
TCATGAAGACAAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGC
GGAAAATGAACAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGG
ACCAAACTATCTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGATGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAATGATCTTTATTTTCTGTTT
GCTTGATAGCGGGCTGGGAACAAATATGCCACAAGCATGACCTAATAACATATTCTTAGCTGGTTGTAATTGAATTGGCTACAGTAGCCTATCGATGCAACTGACCCGGTCGAATCAGTT
TGTTTTTATTTTTTTTTAAATGAGGAACTAATGATGTGGTGTATCCATGATGCTGATTTGTAGGTAAATTATTTCCCTTCAAGGTTTGATTCCGTTCGTCATGCAGAAAAGTTTCCCATG
CCTCCTCCAGTCTTGAATGGAAAGCGAGATAAG
GTAAGTTTCTGGGCCTACCTTGTGCATTTATATCAACATTGACTCTTAAAACATGGGCCCGCCTCTAGGAGAAATAATTAACACTTG
CGTTGAAGTTGTACATTACGATAGTTAATCTGTGGCAAGTTGAAAGGCATTGTGGTGCTGCTGTTTTCTGTTTGGACTTTGGATAAAATTGATTTAACTCAAATTCCGTTNTGCTGGTGC
AATGATCCTGGTGATATCATCCAGCACATTTTCTTCTGCTAGTCTCTCATGTACAAAATTGCCTTTGAGATCGTCCCTACTTGTCCCCAGGGCAATGACAACTCCTTAAAACGACCACTT
TATTGAAATGAGGGGGAGTGTAGTAGCTCCGCTGAATTTTTAGACTAAGCTTAAAACTAAGAAAAGAAGGAGCAAGATGTTATAACTAGAAAAGAGATTCTCTGGCTAGAAAAATGAATT
TCTTGGGNTTTGCCTTGGATTGGATATTTCTGCTGCTGGTATTCATCTCTATGTGAACTTACTGATCATGCAGTGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATA
TCGATCCTGGGCACCGGACAG
GTACCTTTCAACCATTGTCTCCCGAGTAGATGTGTAATTTACTGGTCGCTCATGTGTTTCAAATTTGTCGCCAGGCAAGACCGGTTTATTGGCCGCTGG
GTTGAGACATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAG
GTAAGCTATAAGTATTCACCCCTTTTGCTTTATCCAATGCTACCACAATTC
GTTTAGTGTTGTTACCTGGAAATTGAGAACGTCTGTCTAGAACATGCTCAAATGATCATATGCTGATGGCCTACGATGCATTTTTGCTACAGGCTGACAAATCGCTTGGTCAGAAGATAG
CTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACCCGTACAAGTATCGTCCGTCGAGCGCTCACGATTCCAGCTTCTGGACGACCAACTCCGGCGCCCCTGTCTGGAACAATAACTCATCCCTGACGGTTGGAACTAGAGGTCCTGTT
CTCCTCGAGGATTATCATCTGTTGGAGAAAATTGCCAATTTCGATAGAGAGAGAATACCTGAGCGGGTGGTCCATGCCAGGGGAGCGAGCGCAAAAGGATTTTTCGAGGTCACTCACGAT
ATCTCTCAGTTGACATGTGCTGATTTTCTTCGGGCTCCAGGAGTTCAGACACCTGTAATTGTCCGTTTCTCCNCTGTCATCCATGAGCGTGGCAGCCCTGAAACCCTTAGGGACCCTCGA
GGTTTTGCAGTAAAGTTTTACACCAGAGAG
GGAAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTTTTTATTCGCGATGGTATGAAATTTCCAGACATGNTCCATGCTCTTAAACCC
AACCCGAAGTCTCACATCCAGGAGAACTGGAGAATAGTTGACTTCTTCTCCCACCATCCTGAGAGTTTGCACATGTTTTCCTTCCTCTTCGATGACGTTGGTGTTCCTCAAGACTACAGA
CACATGGAAGGATTTGGGGTTAATACTTACACCTTACTTAACGAGTCTGGAAAGGCACATTATGTGAAATTTCACTGGAAACCAACTTGTGGAGTGAAGTCTTTGCTGGAGGAGGAGGCA
ATACGTGTTGGAGGATCAAATCACAGTCATGCGACTAAGGATCTTTATGACTCGATTGCTGCTGGCAATTACCCAGAGTGGCAACTCTACATCCAAGTTATAGATCCTGATCATGAAGAC
AAATTTGACTTTGATCCACTTGATGTGACAAAAATATGGCCTGAGGACATCGTGCCTCTGCAACCAGTAGGCCGCTTGGTGTTGAATAAGAACATCGATAACTTCTTTGCGGAAAATGAA
CAACTAGCATTTTGCCCTGCAATTGTGGTCCCTGGTGTCTATTACTCTGATGATAAGCTGCTCCAAAGTCGGATTTTCTCCTATGCTGATACTCAGAGACACCGCCTTGGACCAAACTAT
CTTCAACTCCCTGTTAATGCTCCTAAGTGCACTCATCACAACAATCACCATGATGGTTTAATGAATTTCATGCACAGGGATGAAGAG
GTAAATTATTTCCCTTCAAGGTTTGATTCCGTT
CGTCATGCAGAAAAGTTTCCCATGCCTCCTCCAGTCTTGAATGGAAAGCGAGATAAG
TGCATGATTGAGAAGGAGAACAACTTTAAGCAACCGGGAGAGAGATATCGATCCTGGGCACCG
GACAG
GCAAGACCGGTTTATTGGCCGCTGGGTTGAGACATTATCTGATCCCCGGGTTACCCAGGAGATCCGCTCCATCTGGATCTCTTACTGGACTCAGGCTGACAAATCGCTTGGTCAG
AAGATAGCTTCTTGCCTCAATGTGCGGCCAAGCATGTGA

Retrieve as FASTA