Entry information : EguKat01
Entry ID 11399
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguKat01
Name EguKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat01
start..stop
S start..stop
EgrKat01-2 1016 0 1..492 1..492
EglKat01-2 1006 0 5..492 3..490
EgrKat01-1 993 0 1..492 1..492
EglKat01-1 983 0 5..492 1..488
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13599..13613 15 N° 2 13919..14015 97 N° 3 15015..15292 278 N° 4 16256..17032 777
N° 5 17243..17332 90 N° 6 17856..17923 68 N° 7 18001..18094 94 N° 8 18183..18242 60
join(13599..13613,13919..14015,15015..15292,16256..17032,17243..17332,17856..179 23,18001..18094,18183..18242)


exon

Literature and cross-references EguKat01
EST ref. GenBank:   CU394513.1 [5' end]   CU396877.1 [3' end]
Protein sequence: EguKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   56362.21  
PI (pH):   %s   7.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTRGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSHQPESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKTGKTNYVKFHWKPTCGVKCLLEEEAXRIGGSNHSHATKDLXDSIAAGNYPEWKLYIQVMDPALEDSXDFDPLDMTKEWPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYXPSKFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTADKSLGQKLAXRLSARPSM*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_6_20846 (13599..18242)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCGTACAAGGTACCGATCGCTTCATCTTCTCCGCTTCGACTGTCGATCTTTCTTCCATCTTCGCCAGCGGCAGAAATTATCTTTCCCTTTNTCNATCTCNGATCCGTTGATCAT
ATACTGTATTTACGTTAATGGAACCGAGATCTCCCCAATGCTTGTTTGTTTTCGCTTCATCTCCTGTTTGGTAGAAGAAGAGCGCTCCCTGTTGGGACGTTCATGATGCTACGGTTCTGT
TTCNTCGATTTTTCTTATCGCCGGCATGCCGACTTTGCAAAATGCTGATGTGTTTTTGCTGCTAAACGTGGATGTCGCAGTATCGCCCGTCCAGCGCTTACGATTCCAGCTTTTGGACAA
CCAACTACGGTGCTCCCGTCTGGAACAATGACTCATCGCTGACTGTTGGAACTAGAG
GTAGTATCNCCATTACGGATCTCTGAGTTGTTTTCTTTACCGAAAACAATGATAATTCGATGC
TCATCGTGCGTGCGTAGATAGTGCTTGCACTCGAACCGGAATATTTTTACGTTGCCTTTCAGTTTTGCTTCATGCGTGTGATTAATACGTGGTTTGTGGTTTTTTATTCTTGATATAATC
ATTTGAGCACGTTCTTATAAAAAAAAACGTGCACGAGGCTCTCGACTGCATCAATGGGTTCTTTTTATTTTTGTNTTTTGGTGAGTTCGAGGTGTGTACACGCCTTCAACGAATCTAAAC
TTCTAGGTTTTGTAACAGTTTAAGGGAAAAAGCCACCAAGAAGGGAAAACTATGCTCACTTAGACATATTTATTCTCTAAATATTTTCCTGTGACACCAAACATCCAAAATGTAAACATG
TATGACATATTTACTTACACGGACTGTTAAAACTCTGACTACATAGACTTCAAAAAGCAAACGGAGTCACCTAACTTAAGTGAAATTAACTAAAACATCATGTGATAGAACTTTGATGGA
AAGTAAATGTATTGGATATACACAAGTTCAATGTTTTTATGTCACAAAAAAATGTTTAGATAAATATATATAGTTTGAGATTTTTCATATCACAAAAAAAAACTCAGGCTTAATATGTTG
CAATGGACATAAAGGTTTTTATAGTTTTTTTTCTCGATATTAAAGTATAACTCTACAATTTTTCACTTTTTGTGTTCTTCAGCAACTTGTGACAGGAAGGAAAAATATCGTAGTTCTCTT
TTTTTGATAATCTAGAGGCAGGCACGATTGTGGAAACTCGACCCCTAGGCCTTTTTGGGCCGTGAGGGGACCCTGACCCACAGCAGAAGAACCTTGTAGTGATATTAGCTGGTCGCAGGA
GTATCCTTTTTGGCTCTACTTGTGCTCTACACGGACATCGTAGTGAAGACACGGAGCTTAACCGTCATCTAAAAGGAAATTTCTTTCATTTTACAGGTCCGATTCTCCTGGAGGACTACC
ATCTGATAGAGAAACTTGCCAACTTCGAGAGAGAGAGGATTCCTGAGCGGGTGGTCCATGCACGGGGAGCCAGCGCGAAAGGGTTCTTCGAGGTCACCCACGACATCTCTCACTTGACCT
GTGCTGATTTCCTCCGGGCTCCTGGAGTCCAGACGCCCGTCATCGTCCGTTTCTCCACCGTCATCCACGAGCGCGGCAGCCCCGAAACCCTCAGGGACCCTCGTGGTTTTGCAGTGAAGT
TCTACACCAGAGAG
GTAACGAGATGATCACAAGCTTTGAAATCTGCAAATTCCATGTTCTTCGACTTTTTTATTGTTATTATTGCTTGGAACGTGTATCTGTTTAACTGACTATGCATGC
ACTGTGCTTGGCTTTTGTGATTCGGGCAGGGTCTTTGGGCGCGTATGCTCTAAAGCCCGTGCCGAATAGCCACGTGATGATGGATTTTATTTTGACACTTTGACATGACTAGTTGACGAT
AACCATACCGGAGGGCTGTAAAACAAAGAGCTTATTTTAAGGAATAATGTAACCTAGATCGCTTACTTGAGTACCATAAATNTTTTTCTGATCACCTAAATATCATAATTTTTATAAAAA
AAAAAATAGTATATTATGACTTTTTTTATCACTTAAAGGCCATTATTTCTATAAAAAAAAATTATTATTATAGCATCATAATTTTCAATCAATCACTTAAGTGCCAAAATATTTTTAAAA
CATGTACTTAGATGCCAAAGATCTAACGTGGCATTGCACTTAAGATGAATGTTTNAAAAAATATAATGTCACTTAAGTGATCGAAAAAAAAAAGTTATATCACTTAACTAAGCACCATNC
GTAAATAATAGTATTTAAGTGATAAAAAAAATTATGATTTTTAAGTGAACGCCACACAAAATCACGGTACTTATAATGTCCTTTTTTTATTTAAAATAAAAGAGAAAGCTGAACATCAAA
ATACAAACAAGTAGTCTCTCCACATAATTGTATTGTCTCACGTTTCTCTTCTTTTCTTTGATAATTTTTATTTCGACACTTCGATGTGACTAGTTGAAGATGAATTTTTATCGAAGGGCT
GTAATAGAGAGGTTCATTTCAAGTAAGAGAGAAGNCGAGACATCAAAACATGACTAGTATCTCTTCACTTAATTGCGCTGTTTCGCGCTTCTCTTCTTTCCTCCTTTCACCATTCGTTTT
TTTTCTTCTGAACGCAGGGAAACTTTGATCTGGTGGGGAACAATTTCCCAGTCTTCTTCGTTCGCGATGCAATGAAATTCCCGGACGCGATCCATGCGTTCAAGCCGAACCCGAAGTCTA
ACATCCAGGAGATGTGGAGAATCATCGATTTCTTCTCCCACCAGCCCGAGAGTCTGTCCACGTTCGCGTGGTTCTTCGATGATGTNGGCATTCCTCAGGACTACAGGCACATGGAGGGAT
TCGGTGTGCACGCTTTCACCTTCATCAACAAGACCGGAAAGACGAATTACGTNAAATTCCACTGGAAGCCAACTTGCGGGGTGAAGTGCTTGCTGGAGGAGGAGGCGNTCCGCATTGGAG
GATCGAACCACAGCCATGCGACCAAGGATCTTTANGACTCGATCGCTGCTGGCAACTACCCGGAGTGGAAGCTCTACATCCAAGTGATGGATCCAGCTCTTGAAGACAGCTTNGACTTCG
ATCCGCTGGATATGACGAAGGAATGGCCTGAGGACATCTTGCCTCTGCAACCAGTAGGCCGCTTGGTGCTGAACAAAAACGTCGATAACTTCTTCGCTGAGAATGAGCAGCTTGCGTTTA
ACCCAGCATTTGTGGTCCCTGGCATCTATTACTCCAATGATAAGCTTCTCCAAGCTCGGATTTTCGCCTATTCCGATACTCACCGATATCGCCTTGGACCAAACTACCTTCAACTCCCCG
TTAATGCTCCCAAGTGCGCTCATCACAACAACCACCATGATGGTTTCATGAATATCATGCACAGGGATGAAGAG
GTAATGATCTTTATTTTTCTGTTTGCTCAATAACGGCACTGAGAAT
GAACGTGCCTCTAGCATGACCTAATAACATGTTTTTAGCGGCTTGTACAGAGATCTGAATTGGCTATAGTAGTCTATCGATGTAACGCTCGACTCGAATCAGTTTGTTTTTNGATAAAAA
AGGAAGAACTAACGATGTCATTTATCTATGATGCTGATTTGCAGATAAATTATTTNCCTTCGAAATTTGATCCCGTTCGCCATGCAGAAAGGTACCCGATACCGTCTCAAATCGTGACTG
GAAAGCGAGAAAAG
GTAAGTTTACGGAGTCTNTGCATTTATATAAAAAAACGACTCTTAAAAAACATGTTCCTGCCTCCAGGATACCAAGTAAAAGAACGGGAATTGTATGCATGGTATA
AGTAAATCTATTTTGCGTCGATGATTGAGGGGCGGGCTTGGTAAAGATTAAAGCAGGTCGGACTCAGCAGAGAATGCCAGAAGAAATAATTACACGCTTGCGATGAAGGCCCGCCTGCGG
GACAATGGTTAATCTGTGGCAAGTCGAAGGGCATTGCGGCAGTGGTGCTTCTGTTTGGACCTTAGATAAAATTGATGTAGTTCAATTTCTGGTGTGCCGTTGCTATGATTATGGTGCTAT
GATCGTTGGCTCTTACAGACTAAGCTAAGAACTTACAAATGAGGAAGGGAATAAGTTAAAACTACAGAAGAGAAGTCGATGTTTTCGTGGCTTGAAAATGTAGCTCTCGGGGTTCGCCTT
GGATTGGATATCTGTGCTGCTAGTATTAATCTGTATGTGAANTTACTGGTTATGCAGGTCATTATTGAGAAGGAGAACAACTTCAAGCAGCCAGGAGAGAGATACCGATCCTGGGCGCCG
GACAG
GTACCTTTTGACCACNGTCTCCTGAGTCGATGTGCAATTTACTTGGTCACTCAATTGTCTTTCGACTTTGTCGCCAGGCAAGAGCGTTTCATTAACCGCTGGATCAAGGCATTGA
CTGAACCCCGTGTCACCCACGAGCATCGCTCCATCTGGATCTCTTACTGGACTCAG
GTGAGCTATCACTATTCGCCCGGTTTGCTTCCTTTCATGGTACCGAAATTTGTTTATACTGATG
GCCTATGACNCATCTTCACTGCAGGCCGACAAATCGCTCGGCCAGAAGCTTGCTNCCCGCCTCAGCGCACGACCGAGCATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCGTACAAGTATCGCCCGTCCAGCGCTTACGATTCCAGCTTTTGGACAACCAACTACGGTGCTCCCGTCTGGAACAATGACTCATCGCTGACTGTTGGAACTAGAGGTCCGATT
CTCCTGGAGGACTACCATCTGATAGAGAAACTTGCCAACTTCGAGAGAGAGAGGATTCCTGAGCGGGTGGTCCATGCACGGGGAGCCAGCGCGAAAGGGTTCTTCGAGGTCACCCACGAC
ATCTCTCACTTGACCTGTGCTGATTTCCTCCGGGCTCCTGGAGTCCAGACGCCCGTCATCGTCCGTTTCTCCACCGTCATCCACGAGCGCGGCAGCCCCGAAACCCTCAGGGACCCTCGT
GGTTTTGCAGTGAAGTTCTACACCAGAGAG
GGAAACTTTGATCTGGTGGGGAACAATTTCCCAGTCTTCTTCGTTCGCGATGCAATGAAATTCCCGGACGCGATCCATGCGTTCAAGCCG
AACCCGAAGTCTAACATCCAGGAGATGTGGAGAATCATCGATTTCTTCTCCCACCAGCCCGAGAGTCTGTCCACGTTCGCGTGGTTCTTCGATGATGTNGGCATTCCTCAGGACTACAGG
CACATGGAGGGATTCGGTGTGCACGCTTTCACCTTCATCAACAAGACCGGAAAGACGAATTACGTNAAATTCCACTGGAAGCCAACTTGCGGGGTGAAGTGCTTGCTGGAGGAGGAGGCG
NTCCGCATTGGAGGATCGAACCACAGCCATGCGACCAAGGATCTTTANGACTCGATCGCTGCTGGCAACTACCCGGAGTGGAAGCTCTACATCCAAGTGATGGATCCAGCTCTTGAAGAC
AGCTTNGACTTCGATCCGCTGGATATGACGAAGGAATGGCCTGAGGACATCTTGCCTCTGCAACCAGTAGGCCGCTTGGTGCTGAACAAAAACGTCGATAACTTCTTCGCTGAGAATGAG
CAGCTTGCGTTTAACCCAGCATTTGTGGTCCCTGGCATCTATTACTCCAATGATAAGCTTCTCCAAGCTCGGATTTTCGCCTATTCCGATACTCACCGATATCGCCTTGGACCAAACTAC
CTTCAACTCCCCGTTAATGCTCCCAAGTGCGCTCATCACAACAACCACCATGATGGTTTCATGAATATCATGCACAGGGATGAAGAG
ATAAATTATTTNCCTTCGAAATTTGATCCCGTT
CGCCATGCAGAAAGGTACCCGATACCGTCTCAAATCGTGACTGGAAAGCGAGAAAAG
GTCATTATTGAGAAGGAGAACAACTTCAAGCAGCCAGGAGAGAGATACCGATCCTGGGCGCCG
GACAG
GCAAGAGCGTTTCATTAACCGCTGGATCAAGGCATTGACTGAACCCCGTGTCACCCACGAGCATCGCTCCATCTGGATCTCTTACTGGACTCAGGCCGACAAATCGCTCGGCCAG
AAGCTTGCTNCCCGCCTCAGCGCACGACCGAGCATGTAA

Retrieve as FASTA