Entry information : EguKat03
Entry ID 11401
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EguKat03
Name EguKat03
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat03
start..stop
S start..stop
EgrKat03 998 0 1..479 1..479
EglKat03 924 0 1..443 1..443
VvKat02 906 0 1..459 1..459
EcamKat03 906 0 5..459 1..455
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18472..18486 15 N° 2 18981..19077 97 N° 3 20304..20581 278 N° 4 20944..21720 777
N° 5 22003..22092 90 N° 6 22270..22337 68 N° 7 22420..22506 87 N° 8 22688..22712 25
join(18472..18486,18981..19077,20304..20581,20944..21720,22003..22092,22270..223 37,22420..22506,22688..22712)


exon

Literature and cross-references EguKat03
Protein sequence: EguKat03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   479
PWM (Da):   %s   55207.48  
PI (pH):   %s   7.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTRGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLINKAGKVHYVKFHWKPTCGVKNLLEEEAIRVGGSNHSHATQDLYDSIAAGNYPEWKLFIQIIDPDHEDKFDFDPLDVTKTWPEDILPLMPVGRLVLNXNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERYPIPTAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWIDALSDPRMRSAASGFHTGLRPTNLWVR

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_6_22055 (18472..22712)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCGCACAAGGTTNTGACTACCTACCAGTTTTTCGTGCTTCGGTTGCTTGAGCTTGATGCGGGTTGCTTTAAATTTGTCNACTTTTGCGCTCGTTCGCGTCTCGCTTTGGTGCTG
CNTGTGCCCATTTCTTGATTCGTTTCGTCGTCGTCTTCGCCATCGTACTGTTCCAATGATTTTCGCGCCTTCGGACTTCTCTTTCTCGTGCCTCGTTTTTGGTCGTGTTTCGCTTTGAGT
TGAGCTTGGTGATTCGGGGTGGCGAAGAGACTCCTTTTTCTGCTNCTTTCTTTTTTTCTGAAAACTTATTTTGTGGAGCTCTTGCTTTCGGATTAGAATTTTTTGGAGAGGTTGAATTAT
TGTTCTGCGGTCTGTTCATCGTTATTCTCCCGCTAAAATTCGAAGAGAGTTAGAATTCATGCTGTATGCTCGCGTACGGGCTCCTGATTTGCTGCTTGTGNTGTTAAACATTGGTTTCAC
TTGCTAATTATGACGATTGTGCTTTGCAGTACCGTCCATCCAGTGCTTTCAACACTTCTTTCTGGACTACGAACTCTGGTGCTCCTGTCTGGAACAATAACTCTTCGTTGACTGTTGGAA
GCAGAG
GTATACATCCGATGTCCTTGTCTTTTCTTTTCTCTTTCTTGACCGAGGACATGAATTTCTAGTCATTGATAGAGATTCATATAAGTTCAGCCATTCGACAGAAAGGACACCCTT
CTTTGATTGTAGCACTCTCTCTACCCAATTCTGTGTCTTTCGTGCACGTTCGCATCCCTTGTTTTTAGAAGAAAGGAAACTCTCTAGAGTTGATGTTGATATCTGGCCTCTTATGCTAGC
TGGTTGTTTGTCTTCATTGTTTTTCTTTTCCTCTTATAAGTTTGCGCATTAGCAGAGTCCTTCATTTGTGTAATACTTGGATTCTTCATACTTATAGTGTCAGGTAGACCTATCAAACGG
GTGAGTCTTTAACCAAAAAAGAAAAATGTGGGTTGAGTCGAAAATAGTCAAAACTAAATCGATTAATTTAACCCGTTTTGACTCATTTTTATGCAATACAAATCTAAGAACCTATATCCG
ATCTTGACTCATATTGCTAAAATGCTTNTATATCTAATCCAATCGAGNAAAATTCATACCCAAGTTAAGGTGAAAGCATGGAGCAAGCCAGCGAACATGAGATGAAGAGAGTGAAGAGAA
AGTCATGGAGGCCAGTTGGGTTTAAATAAGTCGTGAACCCATTTAGCATCTATATTAAACTTATTTATGACCTATAGAGTTGGGTTGAAACCCATTTATTGAATATAACTAACCCATATA
ACAACTCAACCCATCAAATATGGGTTAAGAAATTGGTCTATAACCCATTTTGACAAGTCTACCGTTTGGCGAGGAAACATGAAAGAAAATCTGCGATATTTTGTTATTGCAAGAGAAGTG
TGTTGATGAACTAGTTAGATTGTTTTGCTAAAAATGGTTTCGTCCAATGTTGTAGTACAAATCTAAATATTATCCCTAATGCCATCCTCACATTCATACATCATTCTCTAATAAAGAAGT
GGAAATCGAAGACTAGCTTGTGCATATAAGTTCAGCTTCCTAGCAATACACTGTTACTTAGAGAGCGGAGCACAGGTCTTATTCTTTGGTAACTAAATAGTTTTTGAAAGTGAGAAGAAT
GATAAGTTAATTTTGACTTTCAGTCAAGGCATATTGGAGTTATAAGTATGTAGGAAAAGTTATGCAAATTAATTAAGCCACAATAGAACCTAACTTTAGAGTAATGCTTAACATGGTAAC
ATGTTTANGGAAAATTAACATCTACATCACAGGTCCAATTCTTCTTGAGGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCAGAGCGTGTGGTGCATGCCAG
AGGAGCCAGTGCAAAGGGATTCTTTGAGGTCACTCATGACATTTCCCAGCTTACCTGTGCTGATTTCCTTCGGGCACCAGGAGTTCAAACACCCGTGATTGTCCGTTTCTCCACTGTCAT
CCACGAAAGGGGCAGCCCTGAAACCCTGAGGGACCCTCGAGGTTTTGCTGTGAAGTTCTACACAAGAGAG
GTAAGGGAATTTTGGTAACAGATAGAAGTCTGCAGTTTGGAAGAGCACAA
GTTTGATGCTCACTGTGATAGACCCTTTCACGGGGAGCCTAGGCTCAATCAATGCATGTGCTATAGATGTGTGGTCAGTAAGAGCTAACTGCTTTTCATATCCCATTCTGCTGAAGCATG
GTTGCATCTATAAATTTCAATAGAATATACTTGGCTCATTTTTCGATTAGTACCTATCTACTAAGAGACATCATATTAATAATTGCTGCTATGGTATTGAATCCACTTCGACACTTGAAT
TGGGGAGATGGCAGGTCTCTTGTACACATTGCATATATTTGTTTTGTGATCTTGCCTTTTCTGTTACTGCAGGGTAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTCTTTGTCCGT
GATGGGATGAAATTCCCGGATATGGTTCATGCACTTAAACCAAACCCCAAATCCCACATCCAGGAGAACTGGAGGATCGTTGACTTTTTCTCCCACCATCCCGAGAGCTTGCACATGTTC
ACCTTCCTCTTTGATGATATTGGTATTCCCCAAGATTACAGGCACATGGAGGGCTCTGGAGTTAACACCTACACCTTGATCAACAAGGCCGGAAAAGTGCATTATGTGAAGTTTCACTGG
AAACCAACTTGCGGGGTCAAGAACTTGCTGGAGGAAGAGGCAATTAGAGTTGGGGGATCCAATCACAGCCATGCGACTCAGGATCTTTATGATTCCATTGCTGCTGGAAACTATCCTGAA
TGGAAACTTTTCATTCAGATCATCGATCCTGATCATGAAGACAAATTTGACTTTGACCCACTTGATGTGACTAAGACCTGGCCCGAAGATATATTGCCCCTAATGCCAGTTGGCCGCTTG
GTCTTGAATANGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGGGTCTTCTACTCAGATGATAAGCTGCTCCAAACTCGTATCTTC
TCGTATTCTGATACTCAGAGGCACCGTCTTGGACCAAATTATCTTCAACTCCCCCCCAATGCTCCTAAATGTGCTCATCACAACAATCACCATGAAGGTTTCATGAATTTCATGCATAGG
GATGAAGAG
GTAAGAATCTTCTTTGAATCCTGCCGCAGCAATACTCTGGGCAGCAACTCTGGTGGATTTTTGGTTGGTGTAACTAAGTTAACATCNCGCTTTCCTTGACATATGAAGGCG
TTGTGATGCAATCTGACATGTCAATTATTGATCCCAAAGTGGCAGTGCAAATGTCCTCTCTCCTTTTGTTGTGTGACTAGATGTATGTGTGTTTACATATGTAGGAAATACCTGTCTGCT
ATTATGTAANAAGATTATCTGTTGAGCAAATGCTTATTTTCCCTTTTGCAGATAAACTATTTTCCATCAAGGTACGATCCTGTTCGTCATGCAGAGAGATATCCCATTCCAACTGCTATG
CTGACTGGAAAGCGTGAAAAG
GTTTGTTTCCTAGGATCTCTTTTACTTGAACAGAAATTGGTTGTCTTGAGGTGCTTTCATGGTGATATTGATGGGATAGACTCAGCTTGTCCAGTAGAT
AATCAATTGAATTGCAGTTAGTTGTGTGACTAGATGTATGTGTGTTTGGATTTTGTTAACTTTTGTTGCTCCAAACAGACCATCATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAG
AGATACCGATCATGGACACCTGACAG
GTATCCTTCAGTTGTGCATATCCTGATAATGGTTTGATGGTCTCATGTTTCTCAATCANNTGTCTCTATCTTCTTTTTTCAGGCAAGAGCGGTT
CATCTGCCGATGGATCGATGCTTTGTCNGACCCACGCATGAGATCCGCAGCATCTGGATTTCATACTGGTCTCAG
GTGAGATAGCTGTTTACTTCTTGTCTAGCCTGATGGAGCTGGAGC
GGGTTAAAGTGAAAAATGTAATATTTAACATGCAGAAATGGGGGATTCGGTTGTTGCTTGCTTTGTGAGATACACACACACACACACATGCNGANGTGATAATGAACTCATTTGAGATTA
CTTGCAATTGCAACAGGCCGACAAATCTCTGGGTCAGAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCCGCACAAGTACCGTCCATCCAGTGCTTTCAACACTTCTTTCTGGACTACGAACTCTGGTGCTCCTGTCTGGAACAATAACTCTTCGTTGACTGTTGGAAGCAGAGGTCCAATT
CTTCTTGAGGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCAGAGCGTGTGGTGCATGCCAGAGGAGCCAGTGCAAAGGGATTCTTTGAGGTCACTCATGAC
ATTTCCCAGCTTACCTGTGCTGATTTCCTTCGGGCACCAGGAGTTCAAACACCCGTGATTGTCCGTTTCTCCACTGTCATCCACGAAAGGGGCAGCCCTGAAACCCTGAGGGACCCTCGA
GGTTTTGCTGTGAAGTTCTACACAAGAGAG
GGTAACTTTGATCTGGTGGGAAACAATTTCCCTGTCTTCTTTGTCCGTGATGGGATGAAATTCCCGGATATGGTTCATGCACTTAAACCA
AACCCCAAATCCCACATCCAGGAGAACTGGAGGATCGTTGACTTTTTCTCCCACCATCCCGAGAGCTTGCACATGTTCACCTTCCTCTTTGATGATATTGGTATTCCCCAAGATTACAGG
CACATGGAGGGCTCTGGAGTTAACACCTACACCTTGATCAACAAGGCCGGAAAAGTGCATTATGTGAAGTTTCACTGGAAACCAACTTGCGGGGTCAAGAACTTGCTGGAGGAAGAGGCA
ATTAGAGTTGGGGGATCCAATCACAGCCATGCGACTCAGGATCTTTATGATTCCATTGCTGCTGGAAACTATCCTGAATGGAAACTTTTCATTCAGATCATCGATCCTGATCATGAAGAC
AAATTTGACTTTGACCCACTTGATGTGACTAAGACCTGGCCCGAAGATATATTGCCCCTAATGCCAGTTGGCCGCTTGGTCTTGAATANGAACATTGATAACTTCTTTGCTGAGAATGAA
CAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGGGTCTTCTACTCAGATGATAAGCTGCTCCAAACTCGTATCTTCTCGTATTCTGATACTCAGAGGCACCGTCTTGGACCAAATTAT
CTTCAACTCCCCCCCAATGCTCCTAAATGTGCTCATCACAACAATCACCATGAAGGTTTCATGAATTTCATGCATAGGGATGAAGAG
ATAAACTATTTTCCATCAAGGTACGATCCTGTT
CGTCATGCAGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAG
ACCATCATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCATGGACACCT
GACAG
GCAAGAGCGGTTCATCTGCCGATGGATCGATGCTTTGTCNGACCCACGCATGAGATCCGCAGCATCTGGATTTCATACTGGTCTCAGGCCGACAAATCTCTGGGTCAGAAAT

Retrieve as FASTA