Entry information : EguKat10
Entry ID 11403
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EguKat10
Name EguKat10
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat10
start..stop
S start..stop
EguKat[P]04 406 2e-143 1..217 133..378
EgrKat[P]04 405 7e-143 1..217 134..379
EgrKat10 383 1e-137 1..200 2..201
EcamKat[P]04 378 3e-132 1..206 126..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30670..31155 486 N° 2 31246..31444 199  
join(30670..31155,31246..31444)


exon

Literature and cross-references EguKat10
Protein sequence: EguKat10
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   25746.52  
PI (pH):   %s   6.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KSHVQENWRILDFFSHHPESFRMFTFLXXDIGIAQDCRHTEGSGVTPYTXINEARKAHHVKFHWKPTCGVKSLLEEEAIRVGGFNHSHTTRDLYDSIAAGNYPEWELFIQIVDPDHEDKFDXDPLDVTKTWPEDILPLMPVRRLVLNRNIDNFFAENEHLAFRLGPNYLQLXPPNALKCAYXNNHHEGFMNFMHRDEEVRIFFESYRSDTLGRVSCGFFVDVTKASX

Retrieve as FASTA  
Remarks Partial sequence from genomic (PS and 3' end is missing).
scaffold_6_22055 (30670..31444)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATCCCACGTCCAGGAGAACTGGAGGATCCTTGACTTTTTCTCCCACCATCCCGAGAGCTTTCGCATGTTCACCTTCCTCTNTGANGACATTGGTATTGCACAAGATTGCAGGCACACG
GAGGGCTCTGGNGTTACACCNTACACTTTNATCAACGAGGCTAGAAAAGCGCATCATGTGAAGTTCCACTGGAAACCAACTTGCGGGGTCAAGAGCTTGCTGGAGGAAGAGGCAATTAGA
GTTGGTGGATTCAATCACAGCCATACAACTCGGGATCTTTATGATTCCATTGCTGCCGGAAACTATCCTGAGTGGGAACTTTTCATTCAGATTGTCGATCCTGATCATGAAGACAAATTC
GACTTNGACCCACTTGATGTGACTAAGACCTGGCCCGAAGACATATTGCCCCTAATGCCAGTTCGCCGCTTGGTCTTGAATAGGAACATTGATAACTTCTTTGCTGAGAATGAACATCTT
GCATTT
TGCCCTTCAATTGTGGTTCCCGGCGTCTACTGCTTAGATGATTGGCTGCTTCAAACTCGTATGTTCTCATATTCTGATACTCACAGGCACCGCCTTGGACCAAATTATCTTCAA
CTNNNNCCNCCTAATGCTCTTAAATGTGCTTATCNCAATAATCACCACGAAGGTTTCATGAATTTCATGCATAGGGATGAAGAGGTAAGAATTTTCTTTGAATCCTACCGCAGCGATACT
CTGGGTCGCGTCTCTTGTGGATTTTTTGTCGACGTAACTAAGGCATCACGCTTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAATCCCACGTCCAGGAGAACTGGAGGATCCTTGACTTTTTCTCCCACCATCCCGAGAGCTTTCGCATGTTCACCTTCCTCTNTGANGACATTGGTATTGCACAAGATTGCAGGCACACG
GAGGGCTCTGGNGTTACACCNTACACTTTNATCAACGAGGCTAGAAAAGCGCATCATGTGAAGTTCCACTGGAAACCAACTTGCGGGGTCAAGAGCTTGCTGGAGGAAGAGGCAATTAGA
GTTGGTGGATTCAATCACAGCCATACAACTCGGGATCTTTATGATTCCATTGCTGCCGGAAACTATCCTGAGTGGGAACTTTTCATTCAGATTGTCGATCCTGATCATGAAGACAAATTC
GACTTNGACCCACTTGATGTGACTAAGACCTGGCCCGAAGACATATTGCCCCTAATGCCAGTTCGCCGCTTGGTCTTGAATAGGAACATTGATAACTTCTTTGCTGAGAATGAACATCTT
GCATTT
CGCCTTGGACCAAATTATCTTCAACTNNNNCCNCCTAATGCTCTTAAATGTGCTTATCNCAATAATCACCACGAAGGTTTCATGAATTTCATGCATAGGGATGAAGAGGTAAGA
ATTTTCTTTGAATCCTACCGCAGCGATACTCTGGGTCGCGTCTCTTGTGGATTTTTTGTCGACGTAACTAAGGCATCACGCTTTC

Retrieve as FASTA