Entry information : EguKat[P]04
Entry ID 11405
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EguKat[P]04
Name EguKat[P]04
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat[P]04
start..stop
S start..stop
EgrKat[P]04 854 0 1..433 2..434
EcamKat[P]04 745 0 8..433 1..435
EglKat[P]04 735 0 8..433 1..435
EgrKat03 660 0 8..433 38..471
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30102..30411 310 N° 2 30586..31404 819 N° 3 31929..32000 72 N° 4 32050..32141 92
join(30102..30411,30586..31404,31929..32000,32050..32141)


exon

Literature and cross-references EguKat[P]04
Protein sequence: EguKat[P]04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   432
PWM (Da):   %s   48603.18  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QTIIYVTGPILLDDYHLVEKLANFDRERIPXSAVHARGASAKGFFEVTHDISHLTRADFLQAPGVQTPXNVRFSILIHERGGPETLRDPRGSDVKFYXREVRERSRGKQFPVFFINDGMKFPDIFRALEPDXKSHVQENWRILDFFSHHPESFRMFTFLXXDIGIAQDCRHTEGSGVTPTLXSTEARKAHHVKFHWKPTCGVKSLLEEEAIRVGGFNHSHTTRDLYDSIAAGNYPEWELFIQIVDPDHEDKFDXDPLDVTKTWPEDILPLMPVRRLVLNRNIDNFFAENEHLAFCPSIVVPGVYCLDDWLLQTRMFSYSDTHRHRLGPNYLQLXPNALKCAYXNNHHEGFMNFMHRDEEVRIFFESYRSDTLGRVSSTQTITEKENNFKQPGERYRPWTPV*EKFICRWIDALSDPXV*LMRSAASGFHT

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, stop in frame).
scaffold_6_22055 (30102..32141)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCACAGGTCCAATTCTTCTTGACGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCAGNNAGTGCTGTCCATGCCAGGGGAGCCAGT
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACNCGTGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTNTGAATGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGTGGCCCTGAAACCCTGAGGGACCCTCGNGGTTCTGATGTGAAGTTCTATANAAGAGAGGTAAGGGAGA
CATGAATGTGCAGNATGGACNAGCACGAGTATGATGCTCCCTGTGATGAA
TCCTTTCACAGGTGGCCTAAACTCNACCGATGCATATCGCAGTTCTCTTGTCCACATTGCATACATTTNTTTTGCTGCACTTTGCTGTGTGATCTTACCTTTTNCNTTACTACAGGGTAC
CTTTGATCTCGTGGGAAACAATTCCCCGTCTTCTTTATCAACGATGGGATGAAATTTCCAGATATTTTTCGTGCACTTGAACCAGACCNCAAATCCCACGTCCAGGAGAACTGGAGGATC
CTTGACTTTTTCTCCCACCATCCCGAGAGCTTTCGCATGTTCACCTTCCTCTNTGANGACATTGGTATTGCACAAGATTGCAGGCACACGGAGGGCTCTGGNGTTACACCTACACTTTNA
TCAACNGAGGCTAGAAAAGCGCATCATGTGAAGTTCCACTGGAAACCAACTTGCGGGGTCAAGAGCTTGCTGGAGGAAGAGGCAATTAGAGTTGGTGGATTCAATCACAGCCATACAACT
CGGGATCTTTATGATTCCATTGCTGCCGGAAACTATCCTGAGTGGGAACTTTTCATTCAGATTGTCGATCCTGATCATGAAGACAAATTCGACTTNGACCCACTTGATGTGACTAAGACC
TGGCCCGAAGACATATTGCCCCTAATGCCAGTTCGCCGCTTGGTCTTGAATAGGAACATTGATAACTTCTTTGCTGAGAATGAACATCTTGCATTTTGCCCTTCAATTGTGGTTCCCGGC
GTCTACTGCTTAGATGATTGGCTGCTTCAAACTCGTATGTTCTCATATTCTGATACTCACAGGCACCGCCTTGGACCAAATTATCTTCAACTCCNNCCTAATGCTCTTAAATGTGCTTAT
CNCAATAATCACCACGAAGGTTTCATGAATTTCATGCATAGGGATGAAGAGGTAAGAATTTTCTTTGAATCCTACCGCAGCGATACTCTGGGTCGCGTCTCTT
GTGGATTTTTTGTCGAC
GTAACTAAGGCATCACGCTTTCCTTGAAGTATGAAGGCGTAGTGATGCAATCTGACGTGTCCATTACAGATCCCAAAGTGGCAGTGCGAATGTCCTCTCTCCTTGTTAGCGGAGGATTAC
TTTTTTTATCTTGCAAATGCCCTTTGTGTCTGAAACATGCACACTTGTTTACACATGTAGGAAATTCCNGTCTGTTATTATGTAAAATGATGGATTATCTCTTGAGCAAATGCTTAATTT
CCCTTTTNCAGATAAAACTATTTTCTTTCAAGGTATGATCCCGTTCGTCATGCAGGGAGATATCCATTCCACCTGCTATGCTGACTGGAAAGCGTGAAAAGGTATGTTTCATAATCCTAT
TTTACTTGAATAGAGATTGATTGCTTGAGGTGCTTTCGTGTTGGTATCGATGGGATAGACTCAGCTTGTCCTGTAAATAATCAATTGAATTGCAGTGAGTGGTATGACCGATGTATGTGT
GTTTGGATTTTGTTAATTTTTGTTGGTCCACACAGACTATCACTGAGAAAGAGAACAACTTCAAGCAGCCCGGAGAGAGATACCGACCATGGACGCCTGACAGGTATCCTTCAGTCGTGC
ATTTCCTGATAATGGTGTGATGGTCTCATGTAAGAGAAGTTCATCTGCCGATGGATCGATGCTTTGTCTGACCCACNNGTGTGACTCATGAGATCCGCAGCATCTGGATTTCATACTGGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCACAGGTCCAATTCTTCTTGACGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCAGNNAGTGCTGTCCATGCCAGGGGAGCCAGT
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACNCGTGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTNTGAATGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGTGGCCCTGAAACCCTGAGGGACCCTCGNGGTTCTGATGTGAAGTTCTATANAAGAGAGGTAAGGGAGA
GATCTCGTGGGAAACAATTCCCCGTCTTCTTTATCAACGATGGGATGAAA
TTTCCAGATATTTTTCGTGCACTTGAACCAGACCNCAAATCCCACGTCCAGGAGAACTGGAGGATCCTTGACTTTTTCTCCCACCATCCCGAGAGCTTTCGCATGTTCACCTTCCTCTNT
GANGACATTGGTATTGCACAAGATTGCAGGCACACGGAGGGCTCTGGNGTTACACCTACACTTTNATCAACNGAGGCTAGAAAAGCGCATCATGTGAAGTTCCACTGGAAACCAACTTGC
GGGGTCAAGAGCTTGCTGGAGGAAGAGGCAATTAGAGTTGGTGGATTCAATCACAGCCATACAACTCGGGATCTTTATGATTCCATTGCTGCCGGAAACTATCCTGAGTGGGAACTTTTC
ATTCAGATTGTCGATCCTGATCATGAAGACAAATTCGACTTNGACCCACTTGATGTGACTAAGACCTGGCCCGAAGACATATTGCCCCTAATGCCAGTTCGCCGCTTGGTCTTGAATAGG
AACATTGATAACTTCTTTGCTGAGAATGAACATCTTGCATTTTGCCCTTCAATTGTGGTTCCCGGCGTCTACTGCTTAGATGATTGGCTGCTTCAAACTCGTATGTTCTCATATTCTGAT
ACTCACAGGCACCGCCTTGGACCAAATTATCTTCAACTCCNNCCTAATGCTCTTAAATGTGCTTATCNCAATAATCACCACGAAGGTTTCATGAATTTCATGCATAGGGATGAAGAGGTA
AGAATTTTCTTTGAATCCTACCGCAGCGATACTCTGGGTCGCGTCTCTT
CCACACAGACTATCACTGAGAAAGAGAACAACTTCAAGCAGCCCGGAGAGAGATACCGACCATGGACGCCT
G
TGTAAGAGAAGTTCATCTGCCGATGGATCGATGCTTTGTCTGACCCACNNGTGTGACTCATGAGATCCGCAGCATCTGGATTTCATACTGGT

Retrieve as FASTA