Entry information : EguKat[P]07
Entry ID 11406
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguKat[P]07
Name EguKat[P]07
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat[P]07
start..stop
S start..stop
EgrKat[P]07 359 2e-129 1..182 1..182
EglKat[P]07 348 2e-125 1..177 1..177
EguKat[P]05 342 1e-120 6..177 150..321
EgrKat[P]05 325 5e-114 6..177 150..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 502..769 268 N° 2 1078..1193 116 N° 3 1369..1430 62 N° 4 1514..1613 100
join(502..769,1078..1193,1369..1430,1514..1613)


exon

Literature and cross-references EguKat[P]07
Protein sequence: EguKat[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182
PWM (Da):   %s   20194.1  
PI (pH):   %s   9.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PKTYCPLMXVGRLVLXKNIDNFFAENEQLAFCPSXVVPGVYYSXDKLXQIRIFSYSDAQRDRLAPNYLQLPSNAPKCAHHNSHHEGFMNCLISLLQINYFPSXYXPVRHAERYPIPTAMLTGKREKGIEKENNFKQPGERYRSRAPDRQXRFICRWIDALSEPRMTHEXHSIWISYRSEV

Retrieve as FASTA  
Remarks Pseudogene from genomic. 5' and 3' ends are missing. Scaffold_6_22057 (502..1613)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCNAGTTGGNCGCTTGGTCTTGANTAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAANTGTGGTTCCTGGCGTC
TACTACTCAGANGATAAGCTGCNCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCAC
AACAGTCACCATGAAGGTTTCATGAATT
GCCATGCATAGGATGAAGAGGTAAGAATTTTCTTTGAATCCTTCCTNAGCAATACTCTGGCAGCATCTCTTGTGNATTTTTTGTTGATGTAA
CCAAGTTAGACATCACGCTCTCCTATAAGTATGAAGGCCTAGTGATGCATTCTGACATGTCAATTGTGGATCCCAAAGTGGCGGTGCGAACCCTCCTTTTGTTNGAGGATTACTTTCTTG
ATTTTTCTACTGCCCTTTGTGCCTGAAACATGCATGTTTACATATGTAGGAAATACCTTTCTGCTATCATGTAAAATGATTATCTGTTGAGCAAATGTTTAATTTCCCTTTTGCAGATAA
ACTATTTTCCTTCAAGNTATNATCCNGTTCGTCATGCNGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAAGGTATG
TTTTGTAGGATCTCTTTTACTTGGATAG
AGATTGATTGTCCTGAGGTGCTTTCATGGTGATATCCATGGGATATACTCAACTTGTCCTAGATGATCAATTGAATTGCAGNGAGTGGTATGACTGATGTATGTGTGTTTGGATCTTGTT
ATCTTTTGTTTCTCCTGGCAGACCAACATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCTGACAGGTATTCTTCAGTTGTGCATCTCCTGAAAATG
GTTTGATTGTCTCATGTTTCTCAATAATCTGTCTCTATCTTTCTTTTCTCAGGCAAGANCGGTTCATCTGCCGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATGAGNTCCACA
GCATCTGGATTTCATATAGGTCGGAGGTGAGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCNAGTTGGNCGCTTGGTCTTGANTAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAANTGTGGTTCCTGGCGTC
TACTACTCAGANGATAAGCTGCNCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCGCTCATCAC
AACAGTCACCATGAAGGTTTCATGAATT
GTTTAATTTCCCTTTTGCAGATAAACTATTTTCCTTCAAGNTATNATCCNGTTCGTCATGCNGAGAGATATCCCATTCCAACTGCTATGCTG
ACTGGAAAGCGTGAAAAAGGTATG
ATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCTGACAGGCAAGANCGGTTCATCTGCCGATGGATCGATGCT
TTGTCTGAACCACGTATGACTCATGAGNTCCACAGCATCTGGATTTCATATAGGTCGGAGGTGAGA

Retrieve as FASTA