Entry information : EguKat[P]12
Entry ID 11409
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EguKat[P]12
Name EguKat[P]12
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat[P]12
start..stop
S start..stop
EcamKat[P]06 243 2e-81 1..230 1..237
EgrKat[P]04 202 2e-63 96..244 240..434
EgrKat[P]04 186 7e-57 1..102 2..103
EcamKat[P]11 190 8e-63 1..102 1..102
EcamKat[P]12 189 2e-61 1..102 1..102
EcamKat[P]12 134 7e-40 165..244 103..182
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 366..671 306 N° 2 1283..1464 182 N° 3 1630..1707 78 N° 4 2226..2289 64
N° 5 2375..2466 92  
join(366..671,1283..1464,1630..1707,2226..2289,2375..2466)


exon

Literature and cross-references EguKat[P]12
Protein sequence: EguKat[P]12
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26191.25  
PI (pH):   %s   5.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QTIIYVIGPILLDDYHLXEKLANFDRERIP*SVVHARGACAKGFFEVTHDISHLTHADFLQAPGVQTPVTVRFSILIHERGGPETLRDPRGSXVNFYTRXVRPDHEDNFDFGPLDGAKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLALHFAPSIVVPGVYFMHRDEEVRIVLEYFSSDALGSXSCGQTIIEKENNFKQLGERCRSXFR*EXFICR*IDALSNPRVTXMRSATSGFX

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing; stops in frame, PS is missing).
scaffold_6_22058 (366..2466)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCATAGGTCCAATTCTTCTTGACGATTATCACCTCNTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGAGTGTTGTCCATGCCAGGGGAGCCTGC
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCATGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGCGGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCNTGTGAACTTCTACACNAGANAGGTGAGG
GTCGTTTTGGTAGTAGACATGAATGTGCAGTATGGACGGGCATGAGTATGATGC
TCCCTGTGATGAATCCTTTCACGGGTGGCCTAAACTCGACCNATGCATATGGCAGTTCTCTTGTCCACATTGCATACATTTGTTTTGNTGCACTTTGCTATGTGATCTTACCTTTTCTGT
NACTGCAGGGTAACTTTGATCTGGTAGGAAACAATTTCCCTATCTTCTTTATCCGCNATGGGATGAAATTCCCGGATATGGTTCGTGCACTTAGACCAAACCCCAAATCCCGCGTCCAGG
AGAACTGGAGGATCCTTGACTTTTTCTTCCACCATCCCGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATAGTGCACAAGATTACAGGCACATGCAGGGCTCTGGAGTTAACAC
CTACACTTTGATCAACAAGGCCAGAAAAGCGCATCATGTGAAGTTTCACTGGAAACCAACTTGCGGGTCAAGAGCTTGCTGGAGGAAGAGGCAATTAGAGTCGGGGGATCCAATCACAGC
CATGCAACTCAGGATTTTNTGATTCCATTGCTGCTGGAAACTATCCTGAATGGAAACTTTTCGTTCAGATTGTCAATCCTGATCATGAAGACAACTTCGACTTTGGCCCACTTGATGGGG
CTAAGACCTGGCCCGAGGACATATTGCCCCTAATGCCAGTTGGCCGCTTGGTCTTGAATAGGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTGCATTTTGCNCCTTCAA
TTGTAGTTCCCGGCGTCTA
CGATTCGGATGATAAGCTGCTCCAAACTCGTCATCTCATATTCTGATACTCGGAGGCACTGTCTTGGACCAAAATATCATCAACTCCCACCCCCCCCNNNC
CCNCCTCCCCCCCCAATACTCGTAAATGCGCTCATCACAACAATCACCCTGAAGGTTTCACGAATTTCATGCATAGGGATGAAGAGGTAAGAATCGTCTTAGAATACTTCAGCAGCGATG
CTCTGGGCAGCANCTCTTGTGG
ATTTTTTGTTGATGTAACTNGACATCGTGCTTTCCTATAAGCATGTAGGCGTTGTNATGCAATCTGACATNTCAANTGCGGATCCTAAAGTGGCAGTG
CGAATGTCCTCCCTCCTTTTGANGAAGATTACTTTCTTAATTTTGCAAATGCACTATGNACCTGAAACATNCATACATGTTTACATATGTAGGAAATGCCTNTCTGCTATTATGTAAAAT
GATTATCTGTTGAGCAAATGCTTAATTTCCCTNTTGCANATAAACTATTTTCCATCAAGGTANNATCCCGTTTGTCATGGAGAGAGGTATCCCATTCCACCTGCTATGCTGACTGGAAAG
CATGAAAAGGTGTGTTTTTAGTTAGGATCTCTTTTACGTAAACAGAGATTGATTGTCTTGAGGTGCTTTCATGGCGATGTCCATGGGATAGACTCAGCTTGTCCTAGATGATCAATTGAA
TTGCAGTGAGTAGTGCGACTGATGTATGTGTTTGGATTTTNTTTACTTTTGTTGCTCCAAACAGACCATCATTGAGAAAGAGAACAACTTCAAGCAGCTCGGAGAGAGATGCCGATCATA
NNNN
NNNGACAGGTATTCTTCAGTTGCGCATTTCCTGANAATAGTTTGATGGTCTCATGTTTCTCAATCGTCTGTCTCTGTTTTCATTTTTCAGGTAAGAGNGGTTCATCTGCCGATAGA
TCGATGCTTTATCTAACCCACGTGTGACTCNNATGAGATCCGCAACCTCTGGATTTCATAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAAACTATCATCTACGTCATAGGTCCAATTCTTCTTGACGATTATCACCTCNTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGAGTGTTGTCCATGCCAGGGGAGCCTGC
GCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCATGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCACGAAAGG
GGCGGCCCTGAAACCCTGAGGGACCCCCGGGGTTCTCNTGTGAACTTCTACACNAGANAGGTGAGG
CCTGATCATGAAGACAACTTCGACTTTGGCCCACTTGATGGGGCTAAGACCTGG
CCCGAGGACATATTGCCCCTAATGCCAGTTGGCCGCTTGGTCTTGAATAGGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTGCATTTTGCNCCTTCAATTGTAGTTCCC
GGCGTCTA
TTTCATGCATAGGGATGAAGAGGTAAGAATCGTCTTAGAATACTTCAGCAGCGATGCTCTGGGCAGCANCTCTTGTGGACAGACCATCATTGAGAAAGAGAACAACTTCAAG
CAGCTCGGAGAGAGATGCCGATCATANNNN
TTCAGGTAAGAGNGGTTCATCTGCCGATAGATCGATGCTTTATCTAACCCACGTGTGACTCNNATGAGATCCGCAACCTCTGGATTTCAT
AC

Retrieve as FASTA