Entry information : OsPrx131
Entry ID 1141
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx131
Name OsPrx131
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx131
start..stop
S start..stop
OsPrx136 622 0 1..317 1..317
SiPrx61 594 0 1..317 1..317
SbPrx86 580 0 1..317 1..317
ZmPrx91 474 1e-170 1..317 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 570345..570554 210 N° 2 570640..570831 192 N° 3 571095..571260 166 N° 4 571487..571872 386
join(570345..570554,570640..570831,571095..571260,571487..571872)


exon

Literature and cross-references OsPrx131
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1G2
DNA ref. GenBank:   NC_008404.1 (570345..571869)
Protein sequence: OsPrx131
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   33686.66 (31371.4)  
PI (pH):   %s   7.34 (6.88) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPKSFACSVIALLFAAHLVSAQLSANFYDKSCPNALSTIRTAVRSAVAKENRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKTAAPNNNSLRGFDVIDNIKAQVEGICPQVVSCADILAVAARDSVFALGGPTWVVQLGRRDSTTASLDTANNDIPAPTLDLGDLTKSFSNKGLSATDMIALSGAHTIGQARCVNFRNRIYSETNIDTSLATSLKSNCPNTTGDNNISPLDASTPYTFDNFYYKNLLNKKGVLHSDQQLFNGGSADSQTTTYSSNMATFFTDFSAAIVKMGNIDPLTGSSGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, 3 introns). No ESTs found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCCTAAATCCTTCGCCTGCAGTGTCATTGCCTTGTTGTTTGCTGCACACTTGGTTTCAGCTCAGCTTAGCGCAAATTTCTATGATAAGTCATGCCCTAATGCACTGTCCACC
ATCCGAACAGCGGTGAGATCTGCCGTAGCAAAGGAGAACCGCATGGGTGCATCATTGCTCCGCCTCCACTTCCATGACTGCTTTGTCAAT
GAAAGTGTCCAGAACCTGTACAGATACTCA
AGTTTTTCTCACTTCTAAGTATCAAGTACTAACCTTCAGTATTCTGACAATGCAGGGTTGTGATGGATCGGTGCTGCTAGATGACACCCCAACCTTCACTGGAGAGAAGACCGCCGCCCC
GAACAACAACTCTCTGCGTGGATTCGATGTTATAGACAACATCAAGGCACAGGTTGAGGGGATCTGTCCGCAGGTGGTGTCATGTGCTGACATCCTTGCTGTGGCAGCACGCGACTCTGT
TTTTGCG
GTAAGGGGAGAAAATACAAAGGATATCAAACTAAGAGTTAGTTATTTGTCTGTCTTAAAAAGTTAACAGGAACTCCTGACATCAGTAGATGAGCAACTGAAATGAACAAAACA
TAACTCTTTATGTATAGCTATGAAATTCTATACCAAAACAAGCCTTACAAAGTATTAAAAGTCAAGTTGTCAAAGATAGTAAATAAATTGATTGATATTTATAAAATATAATCAGTAGTG
ACATATAAAAACTGACAATTTATTTTTCAGCTAGGAGGTCCTACTTGGGTTGTCCAGCTGGGACGGCGCGACTCAACAACAGCAAGCCTGGATACTGCAAACAATGACATTCCAGCACCA
ACCCTTGACCTGGGTGATCTCACCAAGTCTTTTTCAAACAAAGGACTAAGCGCAACTGACATGATTGCACTCTCAG
GTACTGTGTATGTAAATTGAACTTTTTGGTATATAATACCATCT
ATAATAAAACCATAAAATAAAACAGCTATCCTTGCTGAAGCTTGATTGTCAAAACAAACTGTACAAGTGGTGTTACATTTACGTAGAGTATCAATATATCATGGTGCAACCCCAACAAGT
TGTTTAGTATCAAGATGCTACTCATCAATTGATCACTAACATCAAATAAAAATATGTGCCAGGGGCTCACACCATAGGCCAGGCAAGGTGCGTCAATTTTCGCAACCGCATCTACAGTGA
GACCAACATCGACACTTCCCTGGCAACATCTCTGAAATCAAATTGTCCAAACACGACCGGCGACAACAACATATCCCCCCTTGATGCATCGACACCCTACACCTTTGACAATTTTTACTA
CAAGAACCTGCTGAACAAGAAGGGTGTCCTGCATTCTGACCAGCAACTATTCAATGGTGGTTCAGCAGATTCCCAGACGACCACCTACTCATCAAACATGGCAACATTTTTCACTGATTT
CAGCGCAGCAATAGTGAAGATGGGCAACATCGACCCCCTTACTGGATCCAGTGGACAGATCAGGAAGAACTGCAGGAAGGTAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCCCTAAATCCTTCGCCTGCAGTGTCATTGCCTTGTTGTTTGCTGCACACTTGGTTTCAGCTCAGCTTAGCGCAAATTTCTATGATAAGTCATGCCCTAATGCACTGTCCACC
ATCCGAACAGCGGTGAGATCTGCCGTAGCAAAGGAGAACCGCATGGGTGCATCATTGCTCCGCCTCCACTTCCATGACTGCTTTGTCAAT
GGTTGTGATGGATCGGTGCTGCTAGATGAC
ACCCCAACCTTCACTGGAGAGAAGACCGCCGCCCCGAACAACAACTCTCTGCGTGGATTCGATGTTATAGACAACATCAAGGCACAGGTTGAGGGGATCTGTCCGCAGGTGGTGTCATGT
GCTGACATCCTTGCTGTGGCAGCACGCGACTCTGTTTTTGCG
CTAGGAGGTCCTACTTGGGTTGTCCAGCTGGGACGGCGCGACTCAACAACAGCAAGCCTGGATACTGCAAACAATGAC
ATTCCAGCACCAACCCTTGACCTGGGTGATCTCACCAAGTCTTTTTCAAACAAAGGACTAAGCGCAACTGACATGATTGCACTCTCAG
GGGCTCACACCATAGGCCAGGCAAGGTGCGTC
AATTTTCGCAACCGCATCTACAGTGAGACCAACATCGACACTTCCCTGGCAACATCTCTGAAATCAAATTGTCCAAACACGACCGGCGACAACAACATATCCCCCCTTGATGCATCGACA
CCCTACACCTTTGACAATTTTTACTACAAGAACCTGCTGAACAAGAAGGGTGTCCTGCATTCTGACCAGCAACTATTCAATGGTGGTTCAGCAGATTCCCAGACGACCACCTACTCATCA
AACATGGCAACATTTTTCACTGATTTCAGCGCAGCAATAGTGAAGATGGGCAACATCGACCCCCTTACTGGATCCAGTGGACAGATCAGGAAGAACTGCAGGAAGGTAAACTAG

Retrieve as FASTA