Entry information : EguPrx01
Entry ID 11410
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EguPrx01
Name EguPrx01
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx01
start..stop
S start..stop
EgrPrx16 694 0 1..337 1..337
EcamPrx01 691 0 1..337 1..337
EglPrx16 691 0 1..337 1..337
EgrPrx01 688 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16036..16278 243 N° 2 16448..16633 186 N° 3 16781..16940 160 N° 4 17057..17481 425
join(16036..16278,16448..16633,16781..16940,17057..17481)


exon

Literature and cross-references EguPrx01
Protein sequence: EguPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (311)
PWM (Da):   %s   36886.18 (34124.7)  
PI (pH):   %s   5.39 (5.39) Peptide Signal:   %s   cut: 27 range:27-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLCXVQHVEAAEGLEPPLTLKWHYYQNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFITGCDASILLDGQNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITDXLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNSK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif YSDC instead of FHDC.
scaffold_1_269 (16036..17481)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCNCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCAGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCCGACTGCTTCATC
ACG
GTACNTATCGTCTGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTNTAACATATAACAATGGTGGAAACCGGGCATGTACGAGCAATAACTTGTTTTTTTCCT
TTAAAAAACAAAGGCTTGTATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCT
TGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GT
ATGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGATTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAGCTTGAACTTGTAGTATTAGATNTGAAAAACCAGAATCGC
TGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCATCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTG
GGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAAAAAAGTAAATAATTGATTTGGACCTCATCAAGTC
ATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCGNAAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTACATCACNGACANGCTGTACAATTAC
AACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCA
GGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTCGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTAT
GATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGC
AAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCNCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCAGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCCGACTGCTTCATC
ACG
GGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCATCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTACATCACNGACANGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTCGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAATAA

Retrieve as FASTA