Entry information : EguPrx05
Entry ID 11413
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2014-04-15 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-21 (Christophe Dunand)
Peroxidase information: EguPrx05
Name EguPrx05
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx05
start..stop
S start..stop
EglPrx15 389 3e-137 1..273 1..333
EglPrx02 374 1e-131 7..274 1..311
EgrPrx[P]07 357 1e-125 20..274 26..274
EglPrx05 348 3e-122 1..272 1..278
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8061..8306 246 N° 2 8475..8660 186 N° 3 9277..9666 390  
join(8061..8306,8475..8660,9277..9666)


exon

Literature and cross-references EguPrx05
Protein sequence: EguPrx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   274 (252)
PWM (Da):   %s   30599.4 (28134.2)  
PI (pH):   %s   7.61 (7.15) Peptide Signal:   %s   cut: 23 range:23-274
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSSMWWQLLLSMLALVSSCAARRIQAEATIELPPPLQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKGCDASVLLDGPDSEKKAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLTGCQFVADRLYNFNKTGKPDPSVDPXFLSQLREQCPPNSTNQVYLNPDSGSSYSLGKTFYSRVLNHRAVLGIDQQIAANNDSYQIAQRYDASFEDFKKMFGRSMTRLGLVKLLPGDQGEVRKNCRVVNAK

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns). Part of the exon 3 is missing (GGP + GRRD) but no 'NNN' in the DNA seq. Containing motif YSDC instead of FHDC. Scaffold_1_267 (8061..9666).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCNTCAATGTGGTGGCAGCTGTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GTCCGTACTGTCTGTTTCTTTTTCCCCCGCTCTCGAACGATCTTGAAGTTTGCATTGCTTCGATATCGAGTTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGT
TTAAACCTCTCGAACCGGGCTTTCTAATGTACCACGCTTTTGTGTATGAAACAGGGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCG
TTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCTGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGATTCGCAGTTTTTCCTTTTTGAGCTTGAAAAGGGATCGTTTGGTCTGCACTGCTGATAATCACTATGCTGTTAGCTTGAGTTTTTGGAGCGTTNGATATGGCAAAAGA
NAAAAACAGAATTACTGATGCGATAATGATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGTT
GCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTGGTACGATCCGAACCTCCCATGAAAACTGCTTATTTGGCTC
CGTTACATTACCTTTAGATCGTAACCAATCCAGGCGAATCGTTCAGTTCAATGAATCATGACGTCCCTTTTCGCTTTCGAGTTTTCTAAATCACTGCCTAGGTGTCATGATACAAAGAAT
TCTTCTGACAGTGATCTCCTCCAAGCGCACAAAATGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACCAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGGG
GCATTCACTGGGCAAGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCANCCTTTTTGTCCCAATTGAGGGAGCAATG
CCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCA
GATTGCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGG
GGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGATCNTCAATGTGGTGGCAGCTGTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTG
GAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCTGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
ACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACC
GGCAAGCCAGACCCAAGCGTGGACCCANCCTTTTTGTCCCAATTGAGGGAGCAATGCCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGC
AAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCAGATTGCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTC
AAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGGGGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA