Entry information : EguPrx08
Entry ID 11414
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: EguPrx08
Name EguPrx08
Class Class III peroxidase    [Orthogroup: Prx119]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx08
start..stop
S start..stop
EgrPrx08 603 0 1..337 1..337
EglPrx08 580 0 1..337 1..338
EguPrx09 576 0 23..337 15..327
EgrPrx09 543 0 1..337 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3658..3906 249 N° 2 3308..3493 186 N° 3 3028..3192 165 N° 4 2385..2810 426
complement(join(2385..2810,3028..3192,3308..3493,3658..3906))


exon

Literature and cross-references EguPrx08
Protein sequence: EguPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (315)
PWM (Da):   %s   36296.25 (33917.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.37 (7.97) Peptide Signal:   %s   cut: 23 range:23-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWWLLLLLALVVLVSSXAMLRVEAAVGIEPPQKLQWHYYRNSCRDAERYVTSQVEFYWKRDKSLAPKLIRMLYADCFVTGCDASILLDGPYSEKTAPQSAGFLGFPMVVIDKIKQILEERCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRRDGMSSSAASVDLPLGAALWGSALAYFESRGLDXLDLTTLLGTGGHSLGKTNCSVIADRLYNFNKTGKPDPSMDSSFLAQMREQCPPNSXNQVYLDPDSGSSYSFSKSFYSRVLNHRAVLGIDQQIAANNDSSQIAQXXDGSFEDFRKRFALSMSRMGNIKVLTGNQGEIRKNCRVVNXKLGQK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif yadc.
scaffold_1_40 (3906..2385)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGCTCGTTGTGTTGGTGAGCTCGTNTGCCATGCTGCGTGTCGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCNTGCCGCGACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GTACGGATCTGTCTGTTCTTATCCTCTCTTGAACGATCTTTNAGTCTGCATCGCTTCAATATCGAGTTTCCATCGCCTCTCTAAGCACACAATATCCTCTCACCCAATGTT
TTAAGNTCTCGAAACGGGCTTTCTGACGTACCGATCTTTTGTGTATAAAACAGGGGTGCGATGCGTCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGT
TTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATCCTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCCGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
G
TATGTGCCTGGTTTGCACTTCTCTCTTTTGGCTTGAAAAAGTTGTTTTCNCTTGAGTTTATAGCGTTAAATGTGGAAAATAAGAANTACTGATACAATGATAATGTTGTCATAGGCGGGA
GGGCCATCGTACCCCGTTCTGGCAGGNAGGAGGGACGGGATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGA
GGCTTGGATGNGCTGGACCTTACTACTCTGCTNGGTACG
NTCGAACCTCNTATGAAAAGTATTTATTTGACCTGGACCTCATTAAATTNCCTTAGATCTTNAGCAATCNGGGCAACTTGT
TTAGTCTAGTGCGGTTGCGAGGAAAAACGNAAAGCATGATGTTCTTTTTCGATTTTAAGTTTTCAAAATCGTTGTCTAATTGTCATGATACGAAGAACCAATTCCTAACTTGCCAAAACA
ATTTAAATTTTGCCAGGGGGGCCATTCATTGGGCAAGACCAACTGCAGCGTCATCGCGGACCGGCTATACAATTTCAACAAAACTGGCAAGCCGGACCCAAGCATGGACTCATCCTTCCT
GGCCCAGATGAGGGAGCAATGCCCACCGAACTCAAANAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGC
CGTCCTCGGCATCGACCAGCAGATCGCCGCCAATAACGACAGCTCCCAGATCGCTCAGNAGTANGATGGCAGTTTCGAGGACTTCCGGAAGAGGTTCGCNCTGTCAATGAGCCGGATGGG
GAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGNAAGCTAGGACAAAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGCTCGTTGTGTTGGTGAGCTCGTNTGCCATGCTGCGTGTCGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCNTGCCGCGACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GGGTGCGATGCGTCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGTTTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATC
CTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCCGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GCGGGAGGGCCATCGTACCCCGTTCTGGCAGGNAGGAGGGACGGG
ATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGAGGCTTGGATGNGCTGGACCTTACTACTCTGCTNGGTACG
GGGGGCCATTCATTGGGCAAGACCAACTGCAGCGTCATCGCGGACCGGCTATACAATTTCAACAAAACTGGCAAGCCGGACCCAAGCATGGACTCATCCTTCCTGGCCCAGATGAGGGAG
CAATGCCCACCGAACTCAAANAATCAAGTGTACCTTGACCCTGACTCAGGCTCCAGCTACAGCTTCAGCAAGTCCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCGGCATCGAC
CAGCAGATCGCCGCCAATAACGACAGCTCCCAGATCGCTCAGNAGTANGATGGCAGTTTCGAGGACTTCCGGAAGAGGTTCGCNCTGTCAATGAGCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACAGNAAGCTAGGACAAAAGTAA

Retrieve as FASTA