Entry information : EguPrx102
Entry ID 11418
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx102
Name EguPrx102
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx102
start..stop
S start..stop
EgrPrx102 647 0 1..323 1..323
EglPrx102 641 0 1..323 1..323
EgrPrx56 589 0 1..323 1..323
EglPrx56 589 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1726..1944 219 N° 2 1446..1634 189 N° 3 372..935 564  
complement(join(372..935,1446..1634,1726..1944))


exon

Literature and cross-references EguPrx102
Protein sequence: EguPrx102
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   34793.75 (32283.4)  
PI (pH):   %s   9.43 (9.07) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAXLXPKPRSCVMIALLLAMVSVSKAVLDAHYYDRTCPQAEKIILQTVQNATRHDPKVPARLLRMFFHXCFIRGCDASLLLDSTPGNKAEKDGPPNISVRAFYVIDDAKAKLEMACPHTVSCADIVAVAARDVVTMAGGPYWNVPKGRKDGRVSNASEXVNLPAPTFNVTQLLQSFAKRGLGLKDLVALSGGHTLGFSHCSSFEARLRNFSLIHDVDPTLNRAFAQQLKNKCPKPNRDRNAGXFLDATSLTFDNVYYRRLVAGEGVFGSDQALYXDYRTRWMVDSFAKDQSLFFREFAASMVRXGNVGVLHNGEVRVNCRTVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
scaffold_7_24529 (1944..372)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTNTTCTTNNGCCGAAGCCTCGCTCTTGCGTGATGATCGCCCTTCTACTGGCNATGGTTTCAGTATCGAAAGCGGTACTTGATGCCCATTACTATGACCGGACATGTCCACAAGCT
GAGAAAATCATATTGCAGACGGTNCAAAATGCCACGAGGCACGACCCCAAAGTCCCCGCTCGCCTCCTTAGGATGTTCTTCCATGANTGTTTCATTCGG
GTATGGACATCTGCAAACTTA
TCTGCAAAATCTCTCTCTCTCTCTCTCTCTCNCNCNCTCATGCGTGTCGTTGGATGGTGCATGCACACAGGGATGTGATGCATCGTTGTTGCTCGACTCTACTCCTGGAAACAAAGCAGA
GAAAGATGGTCCTCCTAATATCTCAGTTCGAGCATTCTATGTGATCGATGATGCCAAAGCAAAGCTTGAAATGGCATGTCCACATACAGTCTCTTGTGCTGATATCGTCGCCGTCGCAGC
TAGAGATGTAGTCACCATG
GTAATANCCAAAACTCCCCAAGCGAGCCAATTCTACCTCATGATGCGCATTGTGTGCANGATCGTTTCTTTATAATTCTCATAATTATTCTGAGCTTTATG
CCNAATCTAACAAAAAGGAAGCTCGCTTGATATCNTCCATGTTCATTAACTTAGTTCTNCCATGTTGGCATAAGATTCACTCAAGAAACTTCAAACTNTTTACTGATAATTATGGTAACG
AGTGAGTGTAGTAAACTCAACCATCATTTCGGAAAAAGCCTAGACTAACATAGTTTTAGAAAGTGTTTATGAAATTATACCAGCGAGCCCGAGAGAAAAAGGAAAAGAATANCNAATAGC
TTCCCACCTTATTACTGTATTTTGTGGTCATGTAGTTATCACTTGATTCGCTTGAAAAGTGACTCTCCATAAAATAAAAATTAATAAGTTGCTCCACACATTGAAAGAATTACTAANGCC
TCGAGATAGCTATTGTGGCATAATATTGTCTATTGCTTTCATTGTTAAGGCTGGAGGGCCATATTGGAACGTGCCAAAAGGCAGAAAAGATGGAAGAGTATCAAATGCTTCAGAANCGGT
CAACTTGCCAGCACCAACATTCAACGTGACNCAACTCCTTCAAAGCTTTGCCAAAAGAGGCTTAGGCCTCAAGGACTTGGTTGCACTATCTGGNGGTCACACTCTTGGCTTCTCTCACTG
TTCCTCTTTCGAAGCCCGGCTTCGTAACTTCAGTCTGATTCATGATGTTGATCCGACCTTGAACCGTGCNTTTGCACAACAGCTGAAGAATAAATGCCCTAAGCCAAACAGGGATCGAAA
TGCAGGACANTTTCTGGATGCCACATCGCTAACCTTCGACAACGTTTACTACAGAAGACTCGTGGCNGGTGAAGGTGTGTTTGGGTCAGATCAAGCACTGTACANTGATTACAGGACAAG
GTGGATGGTCGATTCGTTTGCCAAAGATCAAAGTCTNTTTTTCAGGGAGTTTGCTGCTTCTATGGTAAGANTTGGNAATGTTGGNGTGCTACATAATGGAGAAGTGAGAGTAAACTGCAG
AACGGTAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTNTTCTTNNGCCGAAGCCTCGCTCTTGCGTGATGATCGCCCTTCTACTGGCNATGGTTTCAGTATCGAAAGCGGTACTTGATGCCCATTACTATGACCGGACATGTCCACAAGCT
GAGAAAATCATATTGCAGACGGTNCAAAATGCCACGAGGCACGACCCCAAAGTCCCCGCTCGCCTCCTTAGGATGTTCTTCCATGANTGTTTCATTCGG
GGATGTGATGCATCGTTGTTG
CTCGACTCTACTCCTGGAAACAAAGCAGAGAAAGATGGTCCTCCTAATATCTCAGTTCGAGCATTCTATGTGATCGATGATGCCAAAGCAAAGCTTGAAATGGCATGTCCACATACAGTC
TCTTGTGCTGATATCGTCGCCGTCGCAGCTAGAGATGTAGTCACCATG
GCTGGAGGGCCATATTGGAACGTGCCAAAAGGCAGAAAAGATGGAAGAGTATCAAATGCTTCAGAANCGGTC
AACTTGCCAGCACCAACATTCAACGTGACNCAACTCCTTCAAAGCTTTGCCAAAAGAGGCTTAGGCCTCAAGGACTTGGTTGCACTATCTGGNGGTCACACTCTTGGCTTCTCTCACTGT
TCCTCTTTCGAAGCCCGGCTTCGTAACTTCAGTCTGATTCATGATGTTGATCCGACCTTGAACCGTGCNTTTGCACAACAGCTGAAGAATAAATGCCCTAAGCCAAACAGGGATCGAAAT
GCAGGACANTTTCTGGATGCCACATCGCTAACCTTCGACAACGTTTACTACAGAAGACTCGTGGCNGGTGAAGGTGTGTTTGGGTCAGATCAAGCACTGTACANTGATTACAGGACAAGG
TGGATGGTCGATTCGTTTGCCAAAGATCAAAGTCTNTTTTTCAGGGAGTTTGCTGCTTCTATGGTAAGANTTGGNAATGTTGGNGTGCTACATAATGGAGAAGTGAGAGTAAACTGCAGA
ACGGTAAACTGA

Retrieve as FASTA