Entry information : EguPrx105
Entry ID 11419
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx105
Name EguPrx105
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx105
start..stop
S start..stop
EcamPrx105 690 0 1..339 1..339
EgrPrx105 690 0 1..339 1..339
EglPrx105 647 0 1..339 1..339
EgrPrx109 628 0 1..339 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5359..5595 237 N° 2 5764..5955 192 N° 3 6108..6273 166 N° 4 6428..6852 425
join(5359..5595,5764..5955,6108..6273,6428..6852)


exon

Literature and cross-references EguPrx105
Protein sequence: EguPrx105
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339
PWM (Da):   %s   36336.33  
PI (pH):   %s   5.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MXALYHPRILTMQFLAAIAFISGIIRXGASDPPLTLDYYASSCPNVLEIIRQEMEHEVLSDPHNAALVLRLHFHDCFVQGCDGSVLLDDTVMLRGEKTASPNINSLKGFEIIDRIKSKVESQCPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRXASYELANTNIPTPNQGLISIIYKFLXLGLSVTDTVALSGAHTIGVARCENFRARIYGDYELTSGGSPLSEVHLSQLKSKCPAAGGGDNNTAPLDYETPNTFDXSYYHLLLNGEGLLNSDQELYSSALALQTKQLVEQYALDVAAFFQQFSVSMVKMGNLTNPDSFLNGEVRKSCRFINA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_7_24531 (5359..6852)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGNCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTNCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCA
TCCTCGTGCCCNAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAACGCTGCTTTAGTACTCCGNCTACACTTCCACGACTGCTTCGTTCAG
GTG
CATTGCTTATATCGTAACTCTATGCAATTTTATATTCTGTTGTGTTAAATTGAACATGTACTTTGGGATGAAAGTATGCGTTAGTAGTGACAACCATCNTGAAGCATGGATCAATCTGCA
AAGGGAGAGTGTTTTCTGAATGTTTTGGATGCGATGTTTTATTAGGGATGCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCCCCAAATATAAAC
TCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAATCCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTA
TAGATTGTCNCCTCTCTTTCTCTCNGAATTCCTCATTGNCATGTCAAATAATGTTCNGAATTATAACTTCTGTAGTTATTACTNGCTAACCNAGGAGAAATATCAGAAAATCAATGTGAC
TGATATCGATTCTCTTTCGTACTTNTTAGGTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGNGCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGA
ATCAAGGCCTCATTTCCATCATTTACAAGTTCCTTNACCTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GTAATTATTAAGTTCCTACTCCTTTTTAAGTGATCGANCGAATTA
CTCACCCAAGGTGAGCTTATTGCCACAGAAGAAAGCGCGCTGATNAAGACTTGTATAGTACATTGCATGAGACTTTCGTTTTAACCATNATGCACATGTGAATCGATAGGGGCTCACACG
ATCGGCGTGGCACGCTGTGAGAACTTCCGTGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTNAGCCAATTGAAGTCCAAATGCCCGGCC
GCAGGAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAANTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAGGAACTA
TACTCAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACGAATCCG
GATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGNCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTNCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCA
TCCTCGTGCCCNAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAACGCTGCTTTAGTACTCCGNCTACACTTCCACGACTGCTTCGTTCAG
GGA
TGCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCCCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAA
TCCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGN
GCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTTCCATCATTTACAAGTTCCTTNACCTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GGGCT
CACACGATCGGCGTGGCACGCTGTGAGAACTTCCGTGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTNAGCCAATTGAAGTCCAAATGC
CCGGCCGCAGGAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAANTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAG
GAACTATACTCAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACG
AATCCGGATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCTTGA

Retrieve as FASTA