Entry information : EguPrx109
Entry ID 11420
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx109
Name EguPrx109
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx109
start..stop
S start..stop
EgrPrx109 647 0 1..339 1..339
EcamPrx109 645 0 1..339 1..339
EgrPrx105 629 0 1..339 1..339
EcamPrx105 626 0 1..339 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3158..3394 237 N° 2 2798..2989 192 N° 3 2481..2646 166 N° 4 1903..2327 425
complement(join(1903..2327,2481..2646,2798..2989,3158..3394))


exon

Literature and cross-references EguPrx109
Protein sequence: EguPrx109
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (310)
PWM (Da):   %s   35848.01 (33092.6) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.62 (4.62) Peptide Signal:   %s   cut: 30 range:30-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALFYPGILTMQFLAAIAFISGIXXSGASGPPLTLDYYASSCPNVLEIIHQEMEREVLSDPRNAALVLRLHFHDCFVQGCDGSVLLDDTVXLRGEKTASPNINSLKGFEIXDRIKXKVESECPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRSASYELANTNIPTPNQGLIAIIYKFLYLGLSVTDTXALSGAHTIGVARCENFRARIYGDYELTSGGSPLSEXHLSQLKSTCPAAGGGDNNIAPLDYETPYTFDNSYYHLLLNGEGLLNSDQELYSSVLALQTKQLVEQYALDVAAFFQQFSVSXVKMGNLTNPDSFLNGEVRKSCRFINA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). scaffold_7_25347 (3394..1903)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTATTTTATCCAGGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTNTANGTTCCGGTGCAAGCGGCCCTCCACTGACGCTCGATTATTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATAATCCACCAAGAAATGGAACGTGAGGTGCTCTCTGATCCGCGTAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GTG
CATTGCTTATATCGTAACTCTATGCAATTTTATATTCTGTCGTGTTAAATTGAACATGTACTTTGGGATGAAAGTATGCGTTAGTAGTGACAACCATCATGAAGCATGGATCAATCTGCA
AAGGGAGAGTGTTTTCTGAATGTTTTGGATGCGATGTTTTATTAGGGATGCGACGGTTCGGTNCTGTTGGATGATACGGTCNTGCTACGAGGAGAGAAGACAGCTTCCCCAAATATAAAC
TCTCTAAAAGGTTTTGAAATCATNGATAGGATCAAGANCAAGGTTGAATCCGAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTA
TAGATTGTCCCTCTCTTTCTCTCTGAATTCCTCATTGTCATGTCAAATAATGTTCTGAATTATAACTTCTGTAGTTATTACTTGCTAACCAAGGAGAAATATCAGAAAATCAATGTGACT
GATATCGATTCTCTTTCGTACTTTTTAGGTGGGCGGACCATATTGGGATGTTCCGGTGGGGAGAAAAGACTCAAGAAGCGCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAA
TCAAGGCCTCATTGCCATCATTTACAAGTTCCTTTACCTCGGCCTCTCTGTCACCGACACCNTCGCACTTTCCG
GTAATTATTAAGTTTCTACTCCTCTTTAAGTGAGCGATCGAATTAC
TCACCCAAGGTGAGCTTATTGCCACAGAAGAAAGCGCGCTGATTAAGACTTGTATAGTACATTGCATGANACTTTCCTTTTAACTATATGCACATGTGAATCGCTAGGGGCTCACACGAT
CGGCGTGGCACGCTGTGAGAACTTCCGTGCAAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGNGCACCTGAGCCAATTGAAGTCCACATGCCCGGCCGC
AGGAGGGGGAGATAACAACATCGCGCCTTTGGACTACGAAACGCCCTACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTCAATTCTGACCAGGAACTATA
CTCAAGTGTATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATNGTAAAGATGGGGAACCTCACGAATCCGGA
TAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTATTTTATCCAGGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTNTANGTTCCGGTGCAAGCGGCCCTCCACTGACGCTCGATTATTATGCA
TCCTCGTGCCCAAACGTGCTCGAAATAATCCACCAAGAAATGGAACGTGAGGTGCTCTCTGATCCGCGTAACGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GGA
TGCGACGGTTCGGTNCTGTTGGATGATACGGTCNTGCTACGAGGAGAGAAGACAGCTTCCCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATNGATAGGATCAAGANCAAGGTTGAA
TCCGAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTGGGCGGACCATATTGGGATGTTCCGGTGGGGAGAAAAGACTCAAGAAGC
GCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTGCCATCATTTACAAGTTCCTTTACCTCGGCCTCTCTGTCACCGACACCNTCGCACTTTCCG
GGGCT
CACACGATCGGCGTGGCACGCTGTGAGAACTTCCGTGCAAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGNGCACCTGAGCCAATTGAAGTCCACATGC
CCGGCCGCAGGAGGGGGAGATAACAACATCGCGCCTTTGGACTACGAAACGCCCTACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTCAATTCTGACCAG
GAACTATACTCAAGTGTATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATNGTAAAGATGGGGAACCTCACG
AATCCGGATAGCTTTCTCAATGGAGAAGTGAGGAAGAGTTGCAGATTCATCAATGCATGA

Retrieve as FASTA