Entry information : EguPrx110
Entry ID 11422
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx110
Name EguPrx110
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx110
start..stop
S start..stop
EgrPrx110 656 0 1..339 1..339
EglPrx110 652 0 1..339 1..339
EgrPrx109 556 0 1..338 1..338
EcamPrx109 555 0 1..338 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9513..9749 237 N° 2 9142..9333 192 N° 3 8831..8996 166 N° 4 8252..8676 425
complement(join(8252..8676,8831..8996,9142..9333,9513..9749))


exon

Literature and cross-references EguPrx110
Protein sequence: EguPrx110
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (309)
PWM (Da):   %s   35542.59 (32717.1)  
PI (pH):   %s   4.71 (4.56) Peptide Signal:   %s   cut: 31 range:31-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASIHPRVLAMQFLGXIAFISGVLXSGASDPPLTLDYYASSCPTVFDVIHKEMECAVLSDPRNAAFVVRLHFHDCFVQGXDGSVLLDDTVTLQGEKTASPNINSLDGFXIIDKIKNKVESDCPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRTASSELANTNIPTANEGLTSIISKFLSLGLSVTDTVALSGAHTIGMARCENYRARIYGDYESTSGGSPSSEARLSKLKSTCPAAGGGEDNIAPMDYETXXVFDNSYYHLLLNGEGLLXSDQELYSSVLAIQTKKIAVQYAHDTAAFFQQFSESMVKMGNITNSDSFVNGEVRKNCRFINT

Retrieve as FASTA  
Remarks Complete sequence from genomic. scaffold_7_25347 (9749..8252)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCGATTCATCCAAGAGTCCTCGCGATGCAGTTCTTGGGCNCGATCGCCTTCATTTCTGGTGTTCTACNCTCCGGTGCAAGCGACCCTCCACTNACGCTTGATTACTATGCA
TCTTCGTGCCCGACCGTGTTTGACGTCATCCATAAAGAAATGGAATGCGCGGTGCTCTCAGATCCGCGCAATGCTGCGTTTGTAGTCCGACTACACTTTCATGACTGCTTCGTCCAG
GTG
CATTGCGTATATCGTAATTCTATGCAAATTTCCATTCTCTATAGTTAAATTAAACATGTNCTTGGGAATGAAAGTGGGACAATAGTGACATCAATCATGAAGCATGGATCAAACTGCAAA
GGGAGAATTCCTTTTCTTCTTNTNTTTTGTAATCTTTTGGTTGCAANTTTTACTAGGGATGNGACGGTTCNGTTCTGTTAGACGATACAGTCACGCTGCAAGGAGAGAAGACAGCGTCCC
CAAATATAAACTCTCTAGATGGTTTTNATATCATCGATAAGATCAAGAACAAAGTTGAATCCGACTGCCCTGGAATTGTCTCGTGCGCTGATATATTGACAATTGCTGCTAGAGATGCGG
TCATTCTG
GTATAGATCGTCTTATTTCTCTGAATTCCTCATTTNCTTGTCAAACAATGTTTTGAATTATAATCTATGTTGCTGTACTTCTTAACCAAGGAGAAATATCAGCAAATCAACG
TGATTAATATCGATCCTCTTTNGTACTTTATAGGTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGGAAGGACTCGAGAACTGCAAGCTCCGAGCTCGCAAACACCAACATTCCAACT
GCGAACGAAGGTCTCACTTCCATCATTTCCAAGTTCCTTTCCCTCGGCCTCTCTGTCACCGACACCGTCGCGCTTTCCG
GTAATTATTTAGTTCCTATTCCTCTTATGTGATTGATCAGA
TTACTTTCTCAAGTTGAGCTTACTGCCACAGATTCTAAAGCGCAATGATCAAGGCGTGTATGNTGTCAATTACGTTAAATTTTCCTTAATTATGTGCACATTCCAATCACTAGGGGCTCA
CACGATCGGCATGGCACGATGTGAGAACTACCGTGCGAGGATATACGGNGACTACGAATCAACGTCNGGCGGTAGTCCATCCTCCGAAGCACGCCTCAGCAAATTGAAGTCCACGTGCCC
AGCCGCCGGAGGGGGAGAGGACAACATCGCGCCGATGGACTACGAAACGNCCAANGTATTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTACTCNACTCCGACCAAGA
ACTGTATTCNAGTGTATTGGCGATTCAGACCAAGAAGATTGCGGTACAGTATGCGCATGACACGGCNGCTTTCTTCCAGCAGTTCTCCGAATCCATGGTCAAGATGGGGAACATCACGAA
TTCGGATAGCTTTGTCAATGGAGAAGTGAGGAAGAACTGCAGATTTATCAATACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTCGATTCATCCAAGAGTCCTCGCGATGCAGTTCTTGGGCNCGATCGCCTTCATTTCTGGTGTTCTACNCTCCGGTGCAAGCGACCCTCCACTNACGCTTGATTACTATGCA
TCTTCGTGCCCGACCGTGTTTGACGTCATCCATAAAGAAATGGAATGCGCGGTGCTCTCAGATCCGCGCAATGCTGCGTTTGTAGTCCGACTACACTTTCATGACTGCTTCGTCCAG
GGA
TGNGACGGTTCNGTTCTGTTAGACGATACAGTCACGCTGCAAGGAGAGAAGACAGCGTCCCCAAATATAAACTCTCTAGATGGTTTTNATATCATCGATAAGATCAAGAACAAAGTTGAA
TCCGACTGCCCTGGAATTGTCTCGTGCGCTGATATATTGACAATTGCTGCTAGAGATGCGGTCATTCTG
GTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGGAAGGACTCGAGAACT
GCAAGCTCCGAGCTCGCAAACACCAACATTCCAACTGCGAACGAAGGTCTCACTTCCATCATTTCCAAGTTCCTTTCCCTCGGCCTCTCTGTCACCGACACCGTCGCGCTTTCCG
GGGCT
CACACGATCGGCATGGCACGATGTGAGAACTACCGTGCGAGGATATACGGNGACTACGAATCAACGTCNGGCGGTAGTCCATCCTCCGAAGCACGCCTCAGCAAATTGAAGTCCACGTGC
CCAGCCGCCGGAGGGGGAGAGGACAACATCGCGCCGATGGACTACGAAACGNCCAANGTATTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTACTCNACTCCGACCAA
GAACTGTATTCNAGTGTATTGGCGATTCAGACCAAGAAGATTGCGGTACAGTATGCGCATGACACGGCNGCTTTCTTCCAGCAGTTCTCCGAATCCATGGTCAAGATGGGGAACATCACG
AATTCGGATAGCTTTGTCAATGGAGAAGTGAGGAAGAACTGCAGATTTATCAATACATGA

Retrieve as FASTA