Entry information : EguPrx112
Entry ID 11424
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-13 (Christophe Dunand)
Peroxidase information: EguPrx112
Name EguPrx112
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx112
start..stop
S start..stop
EgrPrx112 638 0 1..319 1..319
EglPrx112 637 0 1..319 1..319
EcamPrx112 629 0 1..319 1..319
EglPrx113 626 0 1..319 14..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15838..16056 219 N° 2 15523..15714 192 N° 3 15205..15367 163 N° 4 14670..15055 386
complement(join(14670..15055,15205..15367,15523..15714,15838..16056))


exon

Literature and cross-references EguPrx112
Protein sequence: EguPrx112
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   34125.66 (31742.4) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.64 (9.78) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATHDXVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRRDSITASRSLANTLPSPASNLSALITSFAAKGLSVKNMVALSGSHTIGLARCSSFRGRIYNDSNIDTSFAHKLQKTCPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQELFNGSSVDSLVKKYAXDTEIFFRDFVRAMIKMSEIKPPKGSNGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_7_25754 (16056..14670)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATNGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GTGAGTCGCGTCTTCTAGAGA
TTCCTTGCGAAACGATCCCACTTTGATTCATTAGCCTTCCAGAGTTTTCCTCTTCTTTTCCTTCCTCCTCAATATTGATGTGTGTATCTACGAATTGGTCAGGGGTGCGATGCGTCGATA
TTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGA
GTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAAT
TTAGTACATTTTTGCCTCGACGGTTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAG
GGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGG
TGGCTCTTTCTG
GTAATTTCAACTCAATATTATCCACCTTGCACCGCGCATTACAACCAAGAATATTCAAAAGAAAAGAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAATGT
CGATGTACTTTATCAGCTGACAGTGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCAGTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTT
CGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAA
GGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCANGCGACACAGAAATTTTTTTCCGAGACTTTGTTAGGGCAATGATCAAAAT
GAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATNGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GGGTGCGATGCGTCGATATTG
TTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTG
GTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCT
AACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGA
TGCAGTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATC
CAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTAT
GCANGCGACACAGAAATTTTTTTCCGAGACTTTGTTAGGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA