Entry information : EguPrx113
Entry ID 11425
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-13 (Achraf Jemmat)
Peroxidase information: EguPrx113
Name EguPrx113
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx113
start..stop
S start..stop
EcamPrx113 639 0 1..315 1..315
EglPrx113 637 0 1..315 19..333
EgrPrx113 636 0 1..315 1..315
EguPrx112 613 0 2..315 7..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34032..34235 204 N° 2 33717..33908 192 N° 3 33394..33559 166 N° 4 32860..33245 386
complement(join(32860..33245,33394..33559,33717..33908,34032..34235))


exon

Literature and cross-references EguPrx113
Protein sequence: EguPrx113
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (295)
PWM (Da):   %s   33911.64 (31952.5)  
PI (pH):   %s   10 (10.00) Peptide Signal:   %s   cut: 21 range:21-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRKDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFRARIYNDSNIDTSFAHKLQKICPRIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQELFNGSSVDSLVKKYARDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_7_25754 (34235..32860)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACNGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GTGAGTCGCGTCTTCTAGAGATTCCTTGCGAAACGA
TCCCACTTTGATTCATTAGCCTTTCAGAGTTTTCCTCTTCTTTTCCNTTCTCCTCAATATTGATGTGTGTATCTACGNATTGGTCAGGGGTGCGATGCGTCGATATTGTTGGATGACACG
CCTAGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCA
GATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAATTTAGTACATTTTTGC
CTCGCCATCGATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCTTGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTC
CATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCTCCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTC
TG
GTAATTTCAACTCAATATTATCACCTTTCACCGCGCATTACAACCAAGAATATTCAAAAGAAAANAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAANGTCGATGTACTTT
NTCAGCTGACAGCGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTCCGAGCTCGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAAT
TGCAGAAGATATGTCCCAGGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTC
ACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCACGCGACACAGGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTA
AGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACNGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GGGTGCGATGCGTCGATATTGTTGGATGACACGCCT
AGCTTCGTGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCAGAT
ATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCT
CCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTC
CGAGCTCGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGATATGTCCCAGGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACC
TTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCACGCGACACA
GGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA